KEGG   Mycobacterium tuberculosis H37Rv: Rv3089Help
Entry
Rv3089            CDS       T00015                                 

Gene name
fadD13
Definition
(RefSeq) long chain-fatty-acid--CoA ligase FadD13
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 888666
NCBI-ProteinID: NP_217605
TubercuList: Rv3089
UniProt: P9WQ37 I6XG57
LinkDB All DBs
Structure
PDB: 

Position
3455761..3457272
Genome map
AA seq 503 aa AA seqDB search
MKNIGWMLRQRATVSPRLQAYVEPSTDVRMTYAQMNALANRCADVLTALGIAKGDRVALL
MPNSVEFCCLFYGAAKLGAVAVPINTRLAAPEVSFILSDSGSKVVIYGAPSAPVIDAIRA
QADPPGTVTDWIGADSLAERLRSAAADEPAVECGGDDNLFIMYTSGTTGHPKGVVHTHES
VHSAASSWASTIDVRYRDRLLLPLPMFHVAALTTVIFSAMRGVTLISMPQFDATKVWSLI
VEERVCIGGAVPAILNFMRQVPEFAELDAPDFRYFITGGAPMPEALIKIYAAKNIEVVQG
YALTESCGGGTLLLSEDALRKAGSAGRATMFTDVAVRGDDGVIREHGEGEVVIKSDILLK
EYWNRPEATRDAFDNGWFRTGDIGEIDDEGYLYIKDRLKDMIISGGENVYPAEIESVIIG
VPGVSEVAVIGLPDEKWGEIAAAIVVADQNEVSEQQIVEYCGTRLARYKLPKKVIFAEAI
PRNPTGKILKTVLREQYSATVPK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacattggctggatgctcagacaacgcgcgaccgtctcgccgcggctgcaagcc
tacgtcgagccgtccaccgacgtccggatgacctacgcgcagatgaacgcgctggcgaac
cggtgcgccgacgtgctcaccgcgctggggatcgccaagggcgaccgcgtggcattgctg
atgcccaacagcgtcgagttctgttgcctgttctatggcgcggccaagctcggcgcggta
gcggtccctatcaacacccgcctcgccgcacccgaggtgagtttcatcctgtccgacagc
ggcagcaaggtggtgatctacggtgcgccgtcggcgccggtgatcgacgccatcagggcg
caggccgaccctccgggcacggtcaccgactggataggcgccgactcgttggccgaacgc
ctgaggtcggcggccgcagacgagccggcggtcgaatgcggcggcgatgacaacttgttc
atcatgtacacctcgggcaccaccggacatcccaagggagtggtgcatacccacgaatcg
gtgcattcggcggccagttcctgggcctcgacgatcgacgtgcgctaccgcgaccgcctg
ctgctaccgctgccgatgttccacgtggcggcgttgacgacggtcatcttcagcgccatg
cgcggcgtcacgctgatctcgatgccgcagttcgatgcgacgaaggtgtggtcactgatc
gtcgaggagcgggtctgtatcggtggcgccgtgccggcgatcctcaacttcatgcgccag
gtgcccgagttcgccgaactcgacgcgcccgacttccgctacttcatcaccggtggcgcg
cccatgccggaggccctgatcaagatctatgccgccaagaacatcgaggtcgtgcagggt
tacgcactcaccgaatcctgtggcggcggcaccctgctgctcagcgaagacgcgctgcgc
aaagccggctcggccggacgcgccaccatgttcaccgacgtggccgtgcgcggtgacgac
ggcgtgatccgcgagcacggcgaaggcgaagtcgtgatcaagtccgacatcctgctcaag
gaatactggaatcgcccggaggccacccgcgacgctttcgacaacggttggttccggacc
ggcgacatcggcgaaatcgatgatgagggctatctttacatcaaggaccggctgaaggac
atgatcatttccggcggcgagaacgtctacccggccgagatcgaaagtgtgatcatcggc
gttcccggggtcagcgaggtggcggtcatcggcttgcccgacgagaagtggggcgagatc
gccgccgccatcgtcgttgccgaccagaacgaggtcagcgagcagcagatcgtcgagtac
tgcggaaccaggctcgcacgctacaagctgcccaagaaggtgatcttcgccgaggccatc
ccccgcaacccgaccggcaagatcctcaaaacggtgctgcgcgaacagtattcggcgacg
gtgccgaagtga

DBGET integrated database retrieval system