KEGG   Mycobacterium tuberculosis H37Rv: Rv3731Help
Entry
Rv3731            CDS       T00015                                 

Gene name
ligC
Definition
(RefSeq) DNA ligase C
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 885771
NCBI-ProteinID: NP_218248
TubercuList: Rv3731
UniProt: L0TDE1
LinkDB All DBs
Position
4181758..4182834
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPE
LVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLL
ALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDG
VIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASV
GVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVP
LRPERVVEVRYDRMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacccgtcatgccgccggtgtcgccgatgctggccaaatcggtcaccgcaatc
ccgccggacgcgtcgtatgaacccaaatgggacggattccgctccatctgctttcgcgac
ggtgatcaggtcgaactgggtagccgcaacgagcggccgatgacccgctacttccccgag
ctggtcgccgcgatcagggccgagctgccgcatcgctgtgtgatcgacggggagatcatc
atcgccaccgaccacggcttggacttcgaggcgctgcaacagcgcatccatcctgccgag
tcgagggtgcgaatgcttgccgaccgcacaccagcctccttcatcgcattcgacctgctg
gccctcggcgacgacgactacaccgggcgaccgttcagcgaaagacgagccgctctggtc
gatgccgtaactggttcgggggccgacgctgacctgtcgatccacgtcaccccggcaacc
accgacatggcgaccgcacaacgatggttctccgagttcgagggggccggtctagacggt
gtcatcgccaaaccgccgcacatcacctatcaaccggacaaacgcgttatgttcaagatc
aaacacctgcggaccgccgattgcgtggtggccggctaccgggtgcacaagtccggcagt
gacgcgatcggctcactgctgctagggctttaccaggaggacggccaactcgcgtcggtc
ggcgtgatcggcgcgttccccatggccgaacgacgccggctattaaccgagctgcagccg
ctggtcaccagcttcgacgaccacccatggaactgggccgcccacgttgccggccagcgc
accccacgtaagaacgagttctcccgctggaatgtcggcaaagacctgtcgttcgtgccg
ctgcgacccgagcgggtggtcgaggtccgctacgaccgcatggaaggcgcgcggttccgc
cacaccgcacagttcaaccggtggcgccccgaccgcgacccacgctcatgcagctatgcc
cagctcgaacgcccgctcaccgtcagcctctccgacattgtgccgggcctacgctaa

DBGET integrated database retrieval system