KEGG   Mycobacterium tuberculosis H37Rv: Rv3826Help
Entry
Rv3826            CDS       T00015                                 

Gene name
fadD23
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase FadD23
  KO
K12425  fatty acid CoA ligase FadD23
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv3826 (fadD23)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Unknown
   Rv3826 (fadD23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 886154
NCBI-ProteinID: NP_218343
TubercuList: Rv3826
UniProt: P9WQ47 I6YD47
LinkDB All DBs
Position
4299812..4301566
Genome map
AA seq 584 aa AA seqDB search
MVSLSIPSMLRQCVNLHPDGTAFTYIDYERDSEGISESLTWSQVYRRTLNVAAEVRRHAA
IGDRAVILAPQGLDYIVAFLGALQAGLIAVPLSAPLGGASDERVDAVVRDAKPNVVLTTS
AIMGDVVPRVTPPPGIASPPTVAVDQLDLDSPIRSNIVDDSLQTTAYLQYTSGSTRTPAG
VMITYKNILANFQQMISAYFADTGAVPPLDLFIMSWLPFYHDMGLVLGVCAPIIVGCGAV
LTSPVAFLQRPARWLQLMAREGQAFSAAPNFAFELTAAKAIDDDLAGLDLGRIKTILCGS
ERVHPATLKRFVDRFSRFNLREFAIRPAYGLAEATVYVATSQAGQPPEIRYFEPHELSAG
QAKPCATGAGTALVSYPLPQSPIVRIVDPNTNTECPPGTIGEIWVHGDNVAGGYWEKPDE
TERTFGGALVAPSAGTPVGPWLRTGDSGFVSEDKFFIIGRIKDLLIVYGRNHSPDDIEAT
IQEITRGRCAAIAVPSNGVEKLVAIVELNNRGNLDTERLSFVTREVTSAISTSHGLSVSD
LVLVAPGSIPITTSGKVRRAECVKLYRHNEFTRLDAKPLQASDL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgctttccatcccctcgatgttgcgccagtgcgtcaacctgcacccggacggc
acggcattcacttacatcgattacgaacgggattcggagggcataagtgaaagcctgacg
tggtcgcaggtgtatcggcgaaccctaaacgttgcagcagaagtccgccgccatgccgca
attggtgaccgtgcagtgatattggccccacaaggactcgattatattgttgcttttctg
ggcgctttacaggccggtcttattgcggttccactttcggctccgctcggcggcgccagc
gatgaacgtgttgacgcggtagtgcgtgacgcgaaacccaatgtcgttctgacaacatcc
gcgataatgggcgatgtcgtcccgcgcgttacgccaccgcccggtattgccagcccgcca
acggttgcggtcgatcaactagatctggactcgccgatacgatctaatattgtggacgat
tctctccaaacaaccgcatatttgcagtatacgtcgggatcgacccgcacacctgccggt
gtaatgattacctacaagaatatattggcaaatttccagcagatgatttccgcctatttc
gccgacaccggagccgtaccgccattggaccttttcattatgtcgtggctaccgttctat
catgacatgggtttggttctgggagtttgtgcgccgattatcgtaggatgcggcgctgtg
ctcacaagcccggtggcgtttctgcagcgaccagcccggtggctgcaattgatggcacgc
gagggccaggcgttttcggcggcaccgaacttcgccttcgaactgacggcagcaaaagca
atagatgacgacttggccgggctcgaccttggacggatcaaaaccatcctctgcggcagt
gaaagggtgcatccggcgaccctcaagcgctttgtcgaccggtttagccgtttcaatctt
cgagaattcgcaattcggcccgcgtacggactcgcggaagccacggtgtatgtggcgacc
agccaagccggccaacccccagaaatccgttacttcgaaccccacgaactttccgctggg
caggccaagccgtgcgcaaccggggcgggcacagctctggtcagttacccgctgccgcaa
tcacccattgttcggatcgtcgatcccaacaccaataccgagtgcccacccggaacaatc
ggtgagatctgggtacacggcgacaatgtcgccggcggctattgggaaaagcctgacgag
actgaacgcaccttcggaggagcactggtcgctccctcggccggcacacccgtagggcct
tggctacgaactggcgactcgggcttcgtgtctgaggacaagtttttcatcatcggcaga
ataaaggatctgttgattgtttacggccgcaatcattctcccgacgacatcgaggcaacg
atccaggagatcactcggggccgctgtgcggcgatagcggttccgagcaatggcgtggag
aagctcgttgccatcgtcgaactcaacaaccgcggcaacttggacacagagaggctgagc
ttcgtcacgcgtgaagtcacctcggcgatatccacctcgcatggattgagcgtgtcggat
ctggttctggtggcgcccggctcgattccgatcaccacgagcggcaaggtcagacgtgcc
gagtgtgtgaagctgtatcgacacaacgagttcacccggttggacgctaagccgttgcaa
gcgagcgatctttag

DBGET integrated database retrieval system