KEGG   Micromonospora tulbaghiae: CSH63_03550Help
Entry
CSH63_03550       CDS       T05651                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00250  Alanine, aspartate and glutamate metabolism
mtua00410  beta-Alanine metabolism
mtua00640  Propanoate metabolism
mtua00650  Butanoate metabolism
mtua01100  Metabolic pathways
mtua01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSH63_03550
   00650 Butanoate metabolism
    CSH63_03550
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSH63_03550
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSH63_03550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtua01007]
    CSH63_03550
Enzymes [BR:mtua01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CSH63_03550
Amino acid related enzymes [BR:mtua01007]
 Aminotransferase (transaminase)
  Class III
   CSH63_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AYF26561
UniProt: A0A386WEN2
LinkDB All DBs
Position
750855..752150
Genome map
AA seq 431 aa AA seqDB search
MTSDDLLARHRAVLPSWMPLYYAEPLELVTGSGRRVTDAAGRTYLDFFGGVLTTMVGHDI
PEIREAVERQLRTGLVHTSTLYLIRQQVELAEKIARLSGIPDARVFFTNSGTEANEAALL
VATNHRRSHQILAVRNSYHGRSYATMGVTGNRGWSASALNPLQVAWLHSGERLRGLLARL
DAADRVDAAVEDLREVLATQTAGDVACLIAEPVQGVGGFVHGPDGLFAAWKKVLDEHGIL
LISDEVQTGWGRTGEHFWGYQAHGVTPDLLTFAKGIGNGFALAGVVGRAEVLESVPAISF
STFGGNPVSTAAGNAVLDYLLDHDLQANAARVGAILGDGLRAATAGLEQVAEVRGKGLML
AVEFVHPGTVEPDAALTTRVFEACRAGGLLVGKGGLYGNVIRMGPPLTLTEDEAREGLAI
MVDAIRASIEA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgacgacctgctggcccggcaccgggccgtgctcccgtcctggatgccgctc
tactacgccgaaccgctggaactggtgaccggttccggccgccgggtcaccgacgcggcc
ggccggacctatctggacttcttcggcggggtgctgaccacgatggtcggtcacgacatc
ccggagatccgcgaggcggtcgaacggcagctgcgtaccggcctcgtgcacacctcgacg
ctctacctgatccgtcagcaggtcgagctggccgagaagatcgcccggctctccggcatc
cccgacgcccgcgtcttcttcaccaactccggcaccgaggcgaacgaggccgcgttgctg
gtcgccacgaatcaccggcgctcgcaccagatcctcgcggtgcgcaacagctaccacggc
cggtcgtacgcgacgatgggcgtcaccggcaaccgcggctggtcggccagcgcgctgaac
ccgttgcaggtggcctggctgcactccggtgaacggctgcgcgggctgctggcccggctc
gacgcggccgaccgggtcgacgcggcggtcgaggacctgcgcgaggtgctcgccacccag
accgcgggcgacgtggcctgcctgatcgccgagccggtccagggcgtgggcggcttcgtg
cacggccctgacgggctcttcgccgcctggaagaaggtgctcgacgagcacggcatcctg
ctgatcagcgacgaggtgcagaccgggtggggccgtaccggcgagcacttctggggctac
caggcgcacggcgtgacaccggatttgctcacgttcgccaagggcatcggcaacggcttc
gcgctcgccggggtggtcggccgggccgaggtgctggagtcggttccggcgatcagcttc
tccacgttcggcggcaacccggtctccaccgccgccggcaacgcggtgctcgactacctg
ctcgaccacgacctccaggccaacgccgcccgggtcggcgcgatcctcggcgacggcctg
cgcgccgccaccgccgggctggagcaggtcgccgaggtgcgcggcaagggcttgatgctc
gccgtcgagttcgtccacccgggaaccgtcgagccggacgcggcgctgaccacccgcgtg
ttcgaggcgtgccgggccggcggcctgctggtcggcaagggcggcctgtacggcaacgtg
atccggatgggcccgccgctgacgctcaccgaggacgaggcccgggagggtctggcgatc
atggtcgacgcgatccgcgcctcgatcgaggcgtga

DBGET integrated database retrieval system