KEGG   Micromonospora tulbaghiae: CSH63_12805Help
Entry
CSH63_12805       CDS       T05651                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00010  Glycolysis / Gluconeogenesis
mtua00071  Fatty acid degradation
mtua00350  Tyrosine metabolism
mtua00625  Chloroalkane and chloroalkene degradation
mtua00626  Naphthalene degradation
mtua01100  Metabolic pathways
mtua01110  Biosynthesis of secondary metabolites
mtua01120  Microbial metabolism in diverse environments
mtua01130  Biosynthesis of antibiotics
mtua01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSH63_12805
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSH63_12805
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CSH63_12805
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CSH63_12805
   00626 Naphthalene degradation
    CSH63_12805
Enzymes [BR:mtua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CSH63_12805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_31 CoA_binding Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AYF28306
UniProt: A0A386WIR9
LinkDB All DBs
Position
2862812..2863822
Genome map
AA seq 336 aa AA seqDB search
MRASVVTAFDRPMEITERPVPEAGPGEILVRVEASGLCHTDIHAARGEWPVKPTPPFVPG
HEGVGLVEQVGPGVTEHAVGDRVALPWLGWACGTCSYCVTGWETLCESQRNTGYSIDGAH
AEYAVASARYAVRVPDGVDPYEAAPLTCAGVTTYKAVKVAGVRPGERVAIFGIGGLGHLA
QQYAQIFGAETVAVDVTAEKLELATSLGAAHTVDAATTDPVERITALGGVDVAIVLAANP
RVIEQAHRSLRRGGRLVLVSLPADNAITLPVFETVLKGITVLGSIVGTRADLAEVFALHA
AGRTRVVYQTRKLDEINDAVDDVLAGRVAARLVLQP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccagtgtcgtcaccgcgttcgaccgtccgatggagatcaccgagcgtcccgtg
ccggaggccggcccgggcgagatcctggtccgcgtcgaagccagcggactctgccacacc
gacatccacgccgcccgcggcgagtggccggtgaagcccaccccgccgttcgtccccggt
cacgagggcgtcggcctggtcgagcaggtcggccccggcgtcaccgagcacgccgtcggc
gaccgggtcgcgctgccctggctcggctgggcctgcggcacctgctcgtactgcgtgacc
ggctgggagacgctgtgcgagtcgcagcgcaacaccggctacagcatcgacggcgcgcac
gccgagtacgcggtggcctcggcccgctacgcggtccgcgtgcccgacggcgtggacccg
tacgaggccgcgccgctgacctgcgcgggcgtcaccacgtacaaggccgtcaaggtcgcc
ggggtgcggccgggcgagcgggtggcgatcttcggcatcggcggcctcggccacctcgcg
cagcagtacgcgcagatcttcggcgccgagacggtcgcggtggacgtgaccgccgagaag
ctggagctggccacgtcgctgggcgcggcgcacaccgtcgacgccgccaccaccgacccg
gtcgagcggatcaccgcgctgggcggcgtggacgtggcgatcgtgctggccgcgaacccc
cgggtgatcgagcaggcccaccgctcgctgcgccgcggcggccggctggtgctggtgtcg
ctgcccgccgacaacgcgatcaccctgcccgtcttcgagacggtgctcaagggcatcacg
gtgctcggctcgatcgtcggcacccgcgccgacctggccgaggtcttcgcgctgcacgcc
gccggccgcacccgggtcgtctaccagacccgcaagctcgacgagatcaacgacgcggtg
gacgacgtcctcgccggccgggtcgccgcccggctcgtgctccagccctga

DBGET integrated database retrieval system