KEGG   Micromonospora tulbaghiae: CSH63_16020Help
Entry
CSH63_16020       CDS       T05651                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mtua  Micromonospora tulbaghiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AYF28934
UniProt: A0A386WQT6
LinkDB All DBs
Position
3560132..3561244
Genome map
AA seq 370 aa AA seqDB search
MDLPINPPVEPMLAKSVAELPTDDGLTYEPKWDGFRCIVFRDGDEVELASRGGKSMTRYF
PEVVEQARRQLPPRCAVDGELIVIRRDGPGGQPRLDFELLAQRIHPAASRVKMLAETTPA
DFVAFDLLAIDDELLTDQPYPRRRERLEQALSGVRPPVHVTQVTTDPETARRWFDVFEGA
GLDGLIVKPADLPYEPGKRLMFKVKHARTMDAVVAGFRWHKSGPVVGSLLLGLYDDDGVL
HHIGVSSSFTMARRKELLDELEPYRDVGGEHPWVHGDHERGQRIPGGVSRWTGGKNLEWE
PLRPALVVEVAYDAMEGDRLRHTARFLRWRPDRDPRSCDYGQLDRPIRYDVDEVLRGDPA
ATVGDTRGRA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgccgatcaaccctccggtcgagccgatgctggccaagagcgtggccgagctg
cccaccgacgacggcctgacctacgagccgaagtgggacggcttccgctgcatcgtgttc
cgcgacggcgacgaggtcgagctggccagccggggcggcaagtcgatgacgcgctacttc
cccgaggtggtcgagcaggcccggcggcagctcccgccccggtgcgcggtcgacggcgag
ctgatcgtgatccgccgggacggcccgggcgggcagccccggctcgacttcgagctgctg
gcccagcggatccatccggccgcctcccgggtcaagatgctggccgagaccaccccggcc
gacttcgtcgcgttcgacctgctggcgatcgacgacgagctgctcacggaccagccctat
ccccggcgccgcgagcggctggagcaggcgctgtccggggtgcgcccaccggtgcacgtg
acgcaggtgaccaccgacccggagacggcccgccgctggttcgacgtgttcgagggcgcc
gggctggacgggctgatcgtcaagccggccgacctgccgtacgagccgggcaagcggctc
atgttcaaggtcaagcacgcgcgcacgatggacgcggtggtggccggtttccgctggcac
aagtccggtccggtggtcggctcgctgctgctcggcctctacgacgacgacggcgtgctg
caccacatcggcgtcagctcctccttcaccatggcccgccgcaaggagctgctcgacgag
ctggagccgtaccgcgacgtcggcggcgagcacccgtgggtgcacggcgaccacgagcgg
ggtcagcgcatcccgggcggggtgagccggtggaccggcggcaagaacctggagtgggag
ccgctgcgcccggcgctggtggtcgaggtggcgtacgacgcgatggagggcgaccggctg
cggcacaccgcccggttcctgcgctggcgtcccgaccgtgatccccgctcctgcgactac
ggccagctcgaccgcccgatccgctacgacgtcgacgaggtgctgcgcggcgatccggcg
gcgacggtcggtgacacccgcggccgggcgtag

DBGET integrated database retrieval system