KEGG   Micromonospora tulbaghiae: CSH63_18175Help
Entry
CSH63_18175       CDS       T05651                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00970  Aminoacyl-tRNA biosynthesis
mtua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSH63_18175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mtua03029]
    CSH63_18175
Enzymes [BR:mtua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CSH63_18175
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CSH63_18175
Mitochondrial biogenesis [BR:mtua03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CSH63_18175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AYF29359
UniProt: A0A1C4VEY2
LinkDB All DBs
Position
complement(4000936..4001241)
Genome map
AA seq 101 aa AA seqDB search
MAAISREEVAHLARLSRLAVTEEELDTFAGQLDVILQSVAQVGEVAAADIPPTSHSVPLT
NVLREDVVRPGLTPQEALSGAPDAEEQRFRVPRILDEDVAS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggccgccatctcccgcgaggaggtcgcgcacctcgcgcgactgtcgcggctcgccgtc
acggaggaggaactggacaccttcgccggccagctggatgtgatcctccagtcggtcgcg
caggtcggcgaggtcgccgcggcggacatcccgccgacgtcccactccgtgccgctgacg
aacgtgctccgcgaggacgtggtgcggccgggcctgaccccgcaggaggcgctgtcgggc
gcccccgacgccgaggagcagcggttccgcgtcccgcggatcctggacgaggatgtggcc
tcatga

DBGET integrated database retrieval system