KEGG   Micromonospora tulbaghiae: CSH63_22810Help
Entry
CSH63_22810       CDS       T05651                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CSH63_22810
Enzymes [BR:mtua01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CSH63_22810
DNA repair and recombination proteins [BR:mtua03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CSH63_22810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydin_ADK
Motif
Other DBs
NCBI-ProteinID: AYF30229
UniProt: A0A386WS79
LinkDB All DBs
Position
complement(4954394..4955308)
Genome map
AA seq 304 aa AA seqDB search
MPSDRFKVEVEGRSLELSNLDKVLFPKAGFTKGEVIDYYTRIAPVLLPHLRDRALTRIRF
PNGVDGGSFFEKNAPAATPGWVRTENLPAPGSTKGRETIDYVVCDELPTLVWLANLAALE
LHTPQWKIGAHPDMMVVDLDPGAPAALKQCCQVAVLMRDRLASDGISSFPKTSGKKGMQL
CCPIAGTQDAEIVSDYAKRIAQELEQAHPKLIVSKMAKNLRPGKVFIDWSQNNAAKTTVA
PYSLRAQSVPSVSTPLTWDEVQAGATGKRPSTRPYTAGEVLKRVEKQGDLLAPLLDGGPE
LPAR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaccggttcaaggtcgaggtcgaggggcgctcgctggagttgtccaacctg
gacaaggtactgttcccgaaggccggcttcaccaagggcgaggtgatcgactactacacc
cggatcgccccggtgctgctgccgcacctgcgcgaccgcgcgctgacccggatccggttc
cccaacggcgtcgacggcggctcgttcttcgagaagaacgcacccgccgcgacccccggt
tgggtacgtaccgagaacctgcccgcccccgggtcgacgaaggggcgggagaccatcgac
tacgtggtctgcgacgaactcccgacgctcgtgtggctggccaacttggccgcgctggag
ttgcacactccgcagtggaagatcggtgcccacccggacatgatggtcgtcgacctggac
ccgggcgcccccgcggcgctcaagcagtgttgccaggtggcggtgctgatgcgcgaccgg
ttggcttccgacgggatctcctcgttccccaagacgtcggggaagaagggcatgcagctc
tgctgcccgatcgccggtacgcaggacgccgagatcgtctccgactacgccaagcgcatc
gcgcaggagctggagcaggcgcacccgaagctgatcgtgtcgaagatggcgaagaacctg
cgccccggcaaggtcttcatcgactggagtcagaacaacgccgcgaagacgacagtggcg
ccgtactcgctgcgggcccagtcggtgccgtcggtgtcgacgccgctgacctgggacgag
gtccaggccggggcgacggggaaacggccgtcgacgcggccgtacacggcgggtgaggtg
ctcaaacgggtggagaagcagggcgacctgctggccccgctgctcgacggcggtcccgaa
ctgcccgcgcgctga

DBGET integrated database retrieval system