KEGG   Micromonospora tulbaghiae: CSH63_25545Help
Entry
CSH63_25545       CDS       T05651                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mtua  Micromonospora tulbaghiae
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtua01001]
    CSH63_25545
Enzymes [BR:mtua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CSH63_25545
Protein kinases [BR:mtua01001]
 Serine/threonine kinases: Other
  Bacterial family
   CSH63_25545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AYF30745
UniProt: A0A386WQS3
LinkDB All DBs
Position
complement(5493877..5495262)
Genome map
AA seq 461 aa AA seqDB search
MLGPGVKLGNRYRLDERIASGGMGDVWRGTDQVLGRTVAVKSLLPALLDEPGFAERFRGE
ARTMATINHPGVVDVYDFGSDQHIAFLVMEYVEGDALSATLSRVGRLTPARTMALLAQAA
DALHAAHEKGIVHRDVKPGNLLVRPNGTLVLTDFGIARSDLVGQLTAAGSVLGTASYISP
EQATGAVATPASDVYALGVVAYQCLAGRRPFEGDNPLEIAMKHVRDAPRALPPDIPPQVR
AIVERAMAKDPAARWPSAAALASIARQAKLALSQAARAGHPISGVPASPAAPVARAQVPT
AMPRPQPPAAAPRPQPRPPVSPAHPPLAAPRPAVVAHPAPQPRPPVAPRGAAPVPQPRPV
PQHNPLGYARPPAAAPPRRSRSGLWTTAIVVAVLVILCSGVISFLYRKYGATASAPASVS
VTSGAVQPYGGDYPVRTSYRREVRLLPAGGGTTTSEGRETR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggtccgggagtcaagctcggcaaccgctaccgcctcgacgagcggatcgccagc
ggtggcatgggcgacgtgtggcgcggcaccgaccaggtgctgggccgtaccgtcgcggtc
aagagcctgctcccggcgctgctggacgaaccgggcttcgccgagcggttccgcggcgag
gcccggaccatggccaccatcaaccaccccggcgtggtcgacgtctacgacttcggcagc
gaccagcacatcgcgttcctggtgatggagtacgtcgagggcgacgcgctctccgccacg
ctcagccgcgtcggccggctgaccccggcgcgcacgatggcgctgctggcgcaggccgcc
gacgcgttgcacgcggcgcacgagaagggcatcgtgcaccgcgacgtgaagcccggcaac
ctgctggtccggccgaacggcacgctcgtgctcaccgacttcggcatcgcccgctcggac
ctggtcggccagctcaccgccgccggctcggtgctcggcaccgcctcgtacatctcgccg
gagcaggccaccggcgctgtcgccacccccgcctcggacgtctacgcgctgggcgtggtc
gcgtaccagtgcctggccggccgccgcccgttcgagggggacaaccccctcgaaatcgcc
atgaagcacgtgcgggacgctccgcgggcgctgccgcccgacatcccaccgcaggtccgc
gcgatcgtggagcgggccatggcaaaggacccggccgcgcgctggccgagcgccgccgcg
ctggcgagcatcgcccggcaggccaagctcgcgctctcccaggcggcacgcgccgggcac
ccgatctccggcgtacccgcctcgccggccgcgcccgtcgcgcgggcgcaggtgccgacc
gccatgccgcgtccgcagccgccggccgccgccccccgtccgcaaccccggccgcccgtg
tccccggcccacccgccgctcgccgcgccgcgcccggcagtggtcgcgcaccccgccccg
cagccccgcccgccggtggcgccgcgcggcgcggcccccgtgccgcagccacgccccgtg
ccccagcacaaccccctggggtacgcgcgaccgcccgccgccgctccgccccggcgctcc
cggtccgggctgtggacgaccgcgatcgtggtggccgtactggtcatcctctgctcgggc
gtgatttcgttcctgtaccggaaatacggtgctaccgcatccgctccggcgagtgtgagc
gtgacctccggcgcggtgcagccgtacggaggcgactatccggtccgcacgtcgtaccgt
cgtgaggtacgcctcctgccggccggcggcggtacgacgacgagcgaaggacgagagacg
cgatga

DBGET integrated database retrieval system