KEGG   Micromonospora tulbaghiae: CSH63_28605Help
Entry
CSH63_28605       CDS       T05651                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00564  Glycerophospholipid metabolism
mtua01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CSH63_28605
Enzymes [BR:mtua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CSH63_28605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA NAD_binding_8 Pyr_redox 3HCDH_N HI0933_like AlaDh_PNT_C Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AYF31336
UniProt: A0A386WS83
LinkDB All DBs
Position
6135238..6137055
Genome map
AA seq 605 aa AA seqDB search
MSRSTAGRLSAERRADDLRRLRAERFDVLVIGGGVTGAGAALDAASRGLKVALVEARDYA
AGTSSRSSKLIHGGLRYLEQLEFHLVHEALTERGLLATRLAPHLVRPVPILVPLPAEGGA
RDLPRRFFRRSYYGVGVAAYDAFAGVFGGGRGMPLHRHLTREGTRRIFPSLRPDKLAGAI
RYYDGQVDDARLVVTLARTAASLGATVVTSARAVGLIRQAREVTGVRVRDLEAPAGSPDA
EFEVRARTVIAATGVWSDDMSRMLNDVGLRPKLRVRASKGVHLVVPRSAIVGETGLILRT
ATSVLFVIPWGGHWIIGTTDTDWQLDRSHPAATASDIDYLLSQVNEVLDRPLTTADIEGV
YAGLRPLLAGEADSTSKLSREHAVVEPMLGLLLVAGGKYTTYRVMASDVVDRAMHRLGRT
RPSRTADLPLLGADGYAAMWRDRADLARRHGVAVGVVEHLLERYGTLTLDLLALVDADPL
LGSPLAGAPEYLAAEVTYAARAEGALHLEDVLTRRTRISIETSHRGLESAEHAAELMGAV
LGWDAATRDREVAHYRARVLAERESQLMTDDIAADAARLGAPDVRGFAADRGTDGPGVEL
PASPR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgatccacggccggccggctctccgccgagcgccgcgccgacgacctgcgccgg
ctccgggccgagcggttcgacgtgctggtcatcggcggtggcgtgaccggagcgggcgcc
gcgctcgacgccgcgtcccgagggctgaaggtcgccctggtggaggcgcgcgactacgcc
gccggcacgtccagccggtccagcaagctgatccacggcggcctgcgctacctggagcag
ctggagttccacctggtccacgaggcgctgaccgagcgcggcctgctcgccacgcggctc
gcgccgcacctggtccggccggtgccgatcctggtgccgctcccggccgagggcggcgcg
cgtgacctgccccggcgcttcttccgccgctcctactacggcgtcggcgtggccgcgtac
gacgcgttcgccggggtgttcggcggcgggcgcggcatgccgctgcaccggcacctcacc
cgcgagggcacccgccggatcttccccagcctgcgcccggacaagctggccggcgcgatc
cgctactacgacggccaggtcgacgacgcccgcctggtggtgacgctggcgcgcaccgcg
gccagcctcggcgcgacagtggtgacgagcgcccgcgcggtcggcctgatccgccaggcc
cgggaggtcaccggcgtgcgggtccgcgacctggaggcgcccgccggttcgccggacgcc
gagttcgaggtacgcgcccgcaccgtgatcgccgccaccggcgtgtggagcgacgacatg
tcgcggatgctcaacgacgtcgggctgcgcccgaagctgcgggtccgggcgtcgaagggg
gtgcacctcgtggtgccccgctcggcgatcgtcggcgagacgggcctgatcctgcgtacc
gcgacgagcgtgttgttcgtgatcccctggggcgggcactggatcatcggcaccaccgac
acggactggcaactcgaccggtcccacccggccgcgaccgcgagcgacatcgactacctg
ttgtcgcaggtcaacgaggtgctggaccggccgctgaccaccgccgacatcgagggcgtc
tacgccgggctgcgcccgctgctggccggcgaggcggactccacctccaagctctcccgc
gagcacgcggtggtggagccgatgctcggcctgctgctggtcgccggcggcaagtacacc
acctaccgggtgatggcctccgacgtggtcgaccgcgcgatgcaccggctcggccggacc
cgcccctcgcgtaccgccgacctgccgctgctcggcgccgacgggtacgcggccatgtgg
cgggaccgggccgacctggcccgccggcacggggtggcggtcggcgtggtcgagcacctg
ctggagcgctacggcaccctcacgctcgacctgctcgccctggtcgacgccgatccgctg
ctcggctcgccgctggccggcgcaccggaatacctcgccgccgaggtgacgtacgccgcc
cgtgccgagggcgcgctgcacctggaggacgtgctcacccggcgtacccggatctcgatc
gagaccagccaccgcggcctggagtcggcggagcacgccgcggagctgatgggcgcggtg
ctcggctgggacgcggcgacccgggaccgggaggtcgcccactaccgggcgcgggtgctg
gccgagcgggagtcgcagctcatgacggacgacatcgcggccgacgcggcccgcctcggc
gcgcccgacgtacgcgggttcgcggccgaccggggcaccgacggcccgggcgttgaactt
ccggcctcccccaggtag

DBGET integrated database retrieval system