KEGG   Micromonospora tulbaghiae: CSH63_30580Help
Entry
CSH63_30580       CDS       T05651                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mtua  Micromonospora tulbaghiae
Pathway
mtua00020  Citrate cycle (TCA cycle)
mtua00480  Glutathione metabolism
mtua01100  Metabolic pathways
mtua01110  Biosynthesis of secondary metabolites
mtua01120  Microbial metabolism in diverse environments
mtua01130  Biosynthesis of antibiotics
mtua01200  Carbon metabolism
mtua01210  2-Oxocarboxylic acid metabolism
mtua01230  Biosynthesis of amino acids
Module
mtua_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtua_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mtua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSH63_30580
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CSH63_30580
Enzymes [BR:mtua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CSH63_30580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AYF31722
UniProt: A0A386WUK7
LinkDB All DBs
Position
6530549..6531766
Genome map
AA seq 405 aa AA seqDB search
MAKIKVNNPVVEIDGDEMTRIIWKQIREQLILPYLDVDLHYYDLSIQHRDATDDQVTVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKATDFVVPGPGTVTITYTPADGGTPMEMEVANFPGGGIAMG
MYNYDESIRDFARASFRYGLDRNYPVYMSTKNTILKAYDGRFKDIFAEVFENEFKAEFDA
AGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGR
TVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVTEFANTLEK
VIVDTVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARKLAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaacaacccggtcgtggagatcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcac
tactacgacctgtcgatccagcaccgcgacgccaccgacgaccaggtcaccgtcgacgcc
gccaacgccatcaaggagcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcccgggtggaggagttcggcctgaagaagatgtggcggtcgccgaacggcaccatccgc
aacatcctcggcggcgtggtcttccgcgagccgatcatcatgtcgaacgtgccgcggctc
gtcccgggctggaccaagccgatcatcatcggccggcacgcgcacggcgaccagtacaag
gccaccgacttcgtcgtccccggcccgggcacggtgaccatcacctacaccccggccgac
ggcggcaccccgatggagatggaggtcgccaacttccccggcggcggcatcgccatgggc
atgtacaactacgacgagtcgatccgggacttcgcccgcgcctcgttccggtacggcctg
gaccgcaactacccggtctacatgtcgaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttcgccgaggtgttcgagaacgagttcaaggccgagttcgacgcg
gccggcctcacctacgagcaccggctgatcgacgacatggtcgccgccgcgctcaagtgg
gagggcggttacgtctgggcgtgcaagaactacgacggtgacgtgcagtccgacaccgtg
gcgcagggcttcggctcgctcggcctgatgacctcggtgctgctctccccggacggccgc
accgtcgaggccgaggccgcgcacggcaccgtcacccggcactaccggcagtaccagaag
ggcgagaagacctcgaccaacccgatcgcctcgatctacgcctggacccggggcctggcc
caccggggcaagctggacggcaccccggcggtcaccgagttcgcgaacacgctggagaag
gtcatcgtggacaccgtcgagggcggccagatgaccaaggacctcgcgctgctcatctcg
cgggacgccccgtggctgaccaccgacgagttcatgaacgcgctcgacgagaacctggcg
cgcaagctcgccgcctga

DBGET integrated database retrieval system