KEGG   Micromonospora tulbaghiae: CSH63_31840Help
Entry
CSH63_31840       CDS       T05651                                 

Definition
(GenBank) polyketide synthase
Organism
mtua  Micromonospora tulbaghiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc adh_short PP-binding Thiolase_N Epimerase GDP_Man_Dehyd PKS_DE Docking Sacchrp_dh_NADP Polysacc_synt_2 SAT RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: AYF31956
UniProt: A0A386WU03
LinkDB All DBs
Position
6859223..6869320
Genome map
AA seq 3365 aa AA seqDB search
MSEEAKLRDYLKRAIADSRRARARLLEAEEQAREPIAIIGMACRYPLGIGSPEALWAAVA
AGTDAISPYPANRGWRDEQFEPGATATASSRTREGAFLTDPGDFDAAFFGISPREALSMD
PQQRQLLETSWEALERAGIKPESLHGSATGVYVGGITQEYPALLAATGLDREGYALTGTT
SSVMSGRVAYALGLEGPAVTVDTACSSSLVAIHLAIHALRAGECGLALASGVNLMATPQF
FVAFSGQGGVAPDGRCKSFAAAADGIGFGEGVGVLVLERLSDAHRNGHRVLAVLRGSAVN
SDGASNGLTAPNGPAQQRVIRRALASARLEPGDVDAVEAHGTGTRLGDPIEAQAILATYG
RGRRDGHPLWLGSAKSNFGHTQAAAGLTGVIKMVMALQHELLPRTLHVDAPTPHVDWSAA
PVRLLTEAQPWPATDRPRRAGVSSFGISGTNAHLILEEAPPAPERDPGPEARVTPPGDQL
PWILSGRTVAALQAQAQRLTDHLVERPGLSPAGIARSLAGTRSAFRHRAVLLGEPPEQIA
ALGALARGEAAAAAVTGVANAGRRVVLVFPGQGGQWPGMGTGLLDSAPVFADRMRDCSAA
LAPYLDYSPEAVLRGEPGAPSLDRVDVTQVVNFALMVSLAALWRSHGIEPAAVIGHSQGE
VAAACVAGALSLEDAARVIAVRGREALRLDGAGGLLSVWLSAGEAEELIEPWGDRLTVGA
VNGPHTVIVSGENAALDELAETCAVRGIRARRVAMRYASHSRYVESIRDDLSRALGEVPA
TPAPVAFYSTVTGALFGTDGLDAAYWYRNLREPVRMHDAVRAALDDECDMFIEVSPHPVL
VGAVQDTIADRSSATVALGTLRRKEPETARMLRSLAEAYVSGAPVDWRGLLGAAPELPVE
LPTYAFQHQRFWVEPPGVTMAAEDSEFWEAVGSDDPDVLAATIGLGDAGEQVSLRDVAPA
LARFHRRRQQESVVDSWRYRVIWRRAEVAPAVPGGTWLVVTAGGDAGPEPAAVERALTLA
GVTVLRLDLQHGTDRGTVATRVREITDRHGELAGVLSYAGLDHRTDLAHAPLTAGAVATI
VLVQGLLDAGVEARLWLVTRGAEQVVPADRPSADAAALAGLARIAGLEHPATWGGVVDLP
GAAARPDADAAVLCGLLAGAADDRGEDQFALRAGGVFVRRLARASRPHSTTDGWRPRGTV
LITGGTGGVGTEVARWLAASGAEHLVLVSRSGATAEGAEALRNELGVPVTLLACDMADRD
AVATMLAAIPAEPRLTAVVHAAGVGAQQTLTELTPAKAARVAAGKAAGARHLDELLGDRP
LDAFVLFSSAAAVWGSAGMAAYAAANAYLDGLAAERRARGRAGTSIAWGGWAGAGMGRLV
ADDAHTRQGVRMMPPALALTALRRAVEQRDVTVTVADVDWPRFAEIFSLSRRRPLLDEVA
EAASAAAEPADDSRAAELGRRLARGTEPERDEIMRNLVRTEAAAVLGYAGNEQLPVDVSF
KDLGFTSVTAVELRQRLASATGLNLPATLVFDHPSVDAVTALLRRRITGELTETTPATPV
TTADDGDPVVIVGMACRYPGGVTDPESLWALLASGADAVGPFPTDRGWTGATDGYVPEGG
FLYDAACFDHGFFGISPREAQAMDPQQRLLLETSWEAIEHAGIDPARLRGSATGVFVGAG
PSDYSALLGAARGGAEGFAMTGTAGSIVSGRISYVLGLEGPAITVDTGCSSSLVTVHLAA
QSLRNAECDLAVAGGVAVMATPVAFTEFARQGGLAADARCKSFAGAADGTGWSEGVGLVV
LERLSAARRNGHRVLAVLRGSAVNSDGASNGLTAPNGPSQERVIRAALASAGLEPADVGA
VEAHGTGTALGDPIEAQALLVTYGRGRPEERPLWLGSIKSNIGHTQAAAGVAGIIKIVLA
LRHELLPRTLHVDEPTPHADWSAGAVRLLTEARPWPRGDRPRRAGISSFGISGTNAHLVV
EEAPPEPAPAPRTPSRPLPVVVTARTPEALAEQAARLGAWLAARPGLSCSDAAYSLMTTR
TSFDHRAVVTADDRNGVLLGLAALAEGRAAPGVYVNRVRRDGKVVFVFPGQGAQWAGMAA
SLWAVSPVFAEAMAECEAALGPFVDWSLREVVHDTVGAPPLERVDVVQPVLFAVMVSLAR
LWESCGVRPSAVVGHSQGEIAAAVVAGALSLADGARVVALRSRALRALAGTGGMATVDLP
LDEVESLLERWDGRLSVAAVNGPRSVVVSGEATALQDLLAHCTGADVRARRIAVDYASHS
GQVEGIRDEITGALAGVAPRPAAIPFYSTLTGSVLSGEELDAEYWYQNLRRPVRLRQVVE
LLDEDGFRVFVECSPHPVLAVGVQDTLHGRDSAAVLLGTLRRDDGGLDRFRASLAEAHLH
GVEVDWPAALGDVEVAPVELPTYPFQHTRHWLDGPARATDVTAAGLTDPAHPLLAAGVEV
ADSGAVVFTARLSRAATPWLGDHVVAGVAVLPATALAEMVAKGGEVVGLGQVDELTLHAP
VLVPAEGAVDLQLTVGPEDEGGRRPVRLHSRSGEPGEAWQVHGSGWLSPAHPEPPSGDLT
AWPPVGAEPVSVDGLYGALAEAGVDLGPAFHGLRAAWTTADALYAEVSLADGMAGDASGH
LIHPALLDAALQGIALGDLLPGGAAGHRPFSFTDLAFYRPVTGTVRVRMTAAGPDSVAVL
LADETGGPVCSIGSLVLRAAPVDEVRAGVAGTHDGLFRIDWVPAPPSAPASASLALVGPD
PLPAGLNGELRRFPGLAELRQVVDAGEPVPDLVLVAGVPAELDADTGLAARTRAATRHVL
ELIRAWTTDERLAHSRLAVVTRGAVATGRQEDVSDPAAAAVWGLLRSAHAEHPERFLVTD
VDDREASARALVTALAGAEEQSALRDGRLLVPRLARLPRDEPGAAPGATFDPDGTVLVTG
ATGGVGSLVAEHLVTAHGVRHLLLVSRSGSAAPGADLLVERLRALGAEITVAACDVGDAA
ALSRLVRQAEADRPLAAVVHSAGVFDDGLLTVLTDKQVDTVYRAKVDAAAHLHELTRDRP
SVPLVLFSSSAGVFGGAGQANYAAANAFLDGLAQHRRSRGLPGVALAWGLWADERGMGGQ
IDEAQRQRHARRGIAAMPAEDALALFDAACRASEAALLPMRLDWPALYAKARVTGVPPLL
RNLVRVARRRTGTDRQELQRRLGGMGEHERTGALVDLVRELVAGVLGYESASAVDQERPF
RDLGFDSLTAVELRNLLNAATGLRLPVTVVFDHPQPLMLAERLASELFAGSGPEMPVGDP
EEERIRRLVAAVPISRLRNAGLLDALLALGDPAAEQERPAGRRAEIEAMDADALVRMAMV
EDSRR
NT seq 10098 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagcaaagctccgcgactacctcaagcgggccatcgcggacagccgccgg
gcgcgggcgcgcctgctcgaggcggaggaacaggcccgcgagccgatcgccatcatcggg
atggcgtgccgctatccgctcggcatcggctcaccggaggcgctgtgggctgccgtcgcc
gccgggacggacgcgatcagcccgtacccggccaaccggggctggcgcgacgagcagttc
gagcccggtgcgaccgcgacggcgagttcgcgtacccgggagggggcgttcctcaccgac
ccgggcgacttcgacgcggcgttcttcggcatctccccccgggaggcgctctcgatggac
ccccagcagcggcagctgctggagacgtcctgggaggcgctggagcgggccggcatcaag
ccggagtcgctgcacggcagcgccaccggcgtctacgtcggcggcatcacccaggagtac
cccgcgctgctcgcggccaccggcctcgaccgcgaggggtacgcactgaccggcaccacc
agtagcgtgatgtccggtcgggtggcgtacgcgttgggcctggagggcccggcggtgacc
gtcgacactgcatgctcctcctccctggtcgccatccacctcgccatccacgccctgcgc
gccggtgagtgcggcctggccctggcctccggggtcaacctgatggccacgccgcagttc
ttcgtcgccttctccggccagggcggggttgcgccggacgggcgctgcaagtccttcgcc
gccgcggccgacggcatcggtttcggtgagggtgtcggcgtcctcgtgctcgaacggctc
agcgacgcccatcgcaacgggcaccgggtgctcgccgtcctgcgcggatccgccgtcaac
tcggacggcgccagcaacgggctcaccgctcccaacggaccggcccagcagcgggtgatc
cgccgcgcattggccagcgcacgcctggagcccggtgacgtcgacgcggtcgaggcgcac
ggcaccggcacccggctcggcgacccgatcgaggcgcaggccatcctggcgacgtacggc
cggggcagacgcgacggccatccgctctggctcggctcggccaagtcgaacttcgggcac
acccaggccgccgccggcctcaccggcgtgatcaagatggtgatggccctccagcacgag
ctgctgccgcgcaccctgcacgtcgacgcgccgaccccgcacgtggactggtcggccgcg
ccggtccggctgctgaccgaggcccagccctggccggccaccgaccggccacgccgcgcc
ggcgtctcctcgttcggcatcagcggcaccaacgcccacctcatcctggaggaggcgccg
ccggccccggaacgggatcccggcccggaggcccgggtcacgccgccgggggaccagctg
ccatggatcctctccggacggaccgtggcggccctgcaagcccaggcccagcggctcacc
gaccacctggtggagcgccccgggctgtcgccggccggcatcgcgaggtcgctggccggc
acccggtccgcgttccggcaccgggcggtgctgctcggcgagccgccagagcagatcgcc
gcactcggcgcgctggctcggggtgaggccgccgccgctgccgtcaccggggtggcgaac
gcgggccggcgggtggtcctcgtcttccccggccagggaggacagtggccgggcatgggc
accggtctgctggactcggcgccggtcttcgccgaccggatgcgggattgttcggcggcg
ctcgcgccgtacctggactactcgccggaggcggtcctacgcggcgagcccggtgcgccg
tcgctggaccgggtggacgtgacccaggtcgtcaacttcgccctcatggtctccctcgcc
gccctgtggcgctcgcacgggatcgaacccgccgcagtgatcgggcacagccagggcgaa
gtggccgcggcctgcgtcgccggcgcactctcgctggaggacgcggcccgggtcatcgcg
gtccggggccgcgaagcgctccgcctggacggtgcgggcggcctgctctcggtgtggctg
tcggccggcgaggcggaggagctgatcgaaccctggggagaccggctcaccgtcggcgcg
gtgaacgggccgcacacggtgatcgtgtccggggagaacgccgccctggacgagctggcc
gagacctgcgccgtccgcgggatccgggcgcggcgggtggcgatgcggtacgcctcccac
tctcgctacgtcgagagcatccgtgacgacctgagtcgggcgctcggcgaggtcccggcc
acgccggcgccggttgccttctattccaccgtcaccggggcgctcttcggcaccgacggg
ctcgacgccgcctactggtaccgcaacctgcgcgaacccgtgcgcatgcacgacgcggta
cgcgccgcgctggacgacgagtgtgacatgttcatcgaggtcagccctcacccggtgctc
gtcggcgcggtacaggacaccatcgcggaccggtcctcggccacggtggcgctgggcacc
ctgcgccggaaggagccggagaccgcccggatgctgcggtccctggccgaggcgtacgtc
tcgggcgcaccggtggactggcggggtctgctcggcgccgcgccggagctcccggtggag
ctcccgacctacgccttccagcatcagcgcttctgggtcgaaccgccgggtgtcacgatg
gccgccgaggactccgagttctgggaagccgtcggcagcgacgacccggacgtgctcgcg
gccaccatcgggctgggcgacgccggcgaacaggtctcgctgcgggacgtggcgccggca
ctggcccgtttccaccggcggcggcagcaggagtccgtggtggactcgtggcgctaccgg
gtgatctggcggcgggccgaggtcgcccccgccgtcccgggcggcacatggctcgtggtg
accgcgggcggggacgcaggcccggagccggccgccgtcgagcgtgccctcaccctggcc
ggcgtgaccgtcctccgcctcgatctgcagcacggcacggaccggggcaccgtcgcgacc
cgggtgcgggagatcaccgaccggcacggtgagctcgccggggtgctgtcgtacgccggc
ctggatcaccggaccgacctggcgcatgccccgctcacggccggcgcggtggccaccatc
gtgctggtacaggggctgctcgacgccggggtcgaagcccggctctggctggtcacccgg
ggcgcggagcaggtggtcccggcggaccggccgtccgcggacgccgccgcgctggccggg
ctggcccgcatcgccggcctggaacaccccgccacctggggtggtgtggtcgacctgccg
ggtgccgcggcccgccccgacgcggacgcggcagtgctctgcggcctgctcgccggagcc
gcggacgaccgtggcgaggaccagttcgcgctccgggccgggggcgtcttcgtacggcgg
ctggctcgcgcgagccgcccgcacagcacgacggacggatggcggccccggggcacggtg
ctgatcaccggtggcaccggcggcgtcggcaccgaggtggcccgctggctggctgcgagc
ggcgcggagcacctcgtcctggtcagccgcagcggagcgacggccgagggtgccgaggcg
ttgcggaacgaattgggcgtaccggtgaccctgctcgcctgcgacatggccgaccgcgac
gcggttgccacgatgctcgcggcgattcccgccgaaccgcggctgaccgcggtcgtgcac
gcggccggtgtcggcgcgcagcagacgctgaccgagctcaccccggccaaagccgcccgc
gtcgcggccggcaaggcggccggtgcccggcacctcgacgagctgctcggcgatcggccg
ctcgacgccttcgtgctcttctcctccgccgcggcggtctggggcagcgcgggcatggct
gcctacgcggcggcgaacgcctacctggacgggctcgccgccgagcgccgggctcgcgga
cgggccggcacctccatcgcctggggcggctgggctggggccgggatgggccggctcgtc
gccgacgacgcgcacacccggcagggcgttcggatgatgcctccggcactcgccctgacc
gcgctgcgccgtgccgtggagcagcgggacgtcacagtgacggtcgccgacgtggactgg
ccccggttcgccgagatcttctccctctcccggcgccgtccgctgctcgacgaggtcgcc
gaggccgcctccgccgcggcggaaccggcggacgactcgcgcgccgccgagcttggtcgc
cgtctggcccggggcaccgagccggagcgcgacgagatcatgcggaacctggtccgcacc
gaggcggccgccgtgctcggctacgccgggaacgagcagctgcccgtcgatgtctccttc
aaggacctgggcttcacctcggtgaccgcggtggagctgcggcagcgcctcgccagcgcc
accggcctgaacctccccgccacgctggtcttcgaccatcccagcgtcgacgcggtgacc
gcgttgctgcgccggcggatcaccggcgagctcaccgagaccacaccggcgaccccggtc
accaccgcggacgacggcgacccggtggtgatcgtcggaatggcctgccgctacccgggg
ggcgtcaccgatcccgagtcgttgtgggcgctgctcgcgagcggcgcggacgcggtgggg
ccgttcccgaccgaccgtggctggaccggcgcgaccgacggctacgtgcccgagggcggc
ttcctctacgacgccgcctgcttcgaccacggcttcttcggtatctcgccgcgcgaggcg
caggcgatggacccgcagcagcggctgctgctcgagaccagctgggaggcgatcgagcac
gccgggatcgacccggcccggctgcgcggcagcgccaccggcgtgttcgtgggcgccggg
ccgtccgactactccgcgctgctgggcgcggcgcgaggcggcgcggaaggcttcgcgatg
accggtacggccgggtccatcgtgtccgggcgcatctcgtacgtgctggggctggaaggc
ccggcgatcaccgttgacaccggctgctcctcgtcgctggtcaccgtccacctcgccgcc
cagtcgctgcggaacgcagagtgcgatctcgccgtggccggtggggtcgccgtgatggcc
acgccggtggcgttcaccgagtttgcccgccagggcgggctggccgctgatgcccggtgc
aagtcgttcgccggtgcggcggacggcaccggctggagcgagggcgtcggcctggtggtc
ctggaacggctctccgccgcccgccgcaacggccaccgcgtgctcgcggtgctgcgcggc
tcggcggtgaactccgacggcgcctcgaacggcctgaccgcgcccaacggaccgtcgcag
gagcgggtgatccgcgcggctctggcctccgccgggctggagccggccgacgtcggggcc
gtggaggcgcacggtaccggcaccgccctgggtgacccgatcgaggcccaggcgctgctc
gtcacctacggccggggtcgtcccgaggaacgaccgctctggctcggctcgatcaagtcg
aacatcggccacacccaggcggcggcgggcgtcgccgggatcatcaagatcgtgctcgcg
ctgcggcacgagctgctgcccaggacgctgcacgtcgacgagccgacaccccacgcggac
tggtcggccggcgcggtgcggctgctgaccgaggcccggccctggccgcgcggagaccgg
cctcggcgggccggcatctcctccttcggcatcagcggcaccaacgcgcacctggtcgtc
gaggaggccccgccggagcccgcgccggcgccgcgtacgccctcccggccgctgcccgtg
gtggtcacggccaggaccccggaggccctggcggagcaggcggcccggctcggcgcctgg
ctcgccgcccggcccgggctgtcctgctccgacgccgcctactcgctgatgaccacccgc
acctccttcgaccaccgggcggtggtgaccgccgacgaccgcaacggcgtgctgctcggc
ctggccgccctggcggagggccgggcggccccgggtgtgtacgtgaaccgcgtccgccgc
gacggcaaggtggtcttcgtcttccccgggcagggcgcgcagtgggcgggaatggcggcg
tcgctgtgggcggtgtcgccggtgttcgcggaggcgatggcggagtgcgaggcggccttg
gggccgttcgtggactggtcgctgcgggaggtcgtgcatgacaccgtgggggcgcctccg
ctggagcgggtcgacgtggtgcagccggtgctgttcgcggtgatggtgtcgctggcccgg
ctctgggagtcctgcggggtgcggccgtccgcggtggtggggcactcgcagggtgagatc
gcggcggccgtggtggcgggcgcgttgtcactggcggacggggcacgggtggtcgcgctg
cggtcgcgggcgctgcgggcgctggccggcaccggcggcatggcgaccgtggacctgccg
ctggacgaggtggagtcgctcctggagcgctgggacggccggttgtcggtggccgccgtg
aacgggccgcgcagcgtcgtcgtctccggcgaggcgacggccttgcaggacctgctcgcg
cactgcaccggcgcggacgtccgggcgcgtcgcatcgcggtggactacgcctcccactcc
ggtcaggtggagggcatccgggacgagatcaccggtgccctggccggtgtcgcgccccgg
ccggccgcgatccccttctactcgacgctcaccggctcggtgctctccggcgaggagctc
gacgccgagtactggtaccagaacctgcgccgcccggtgcggttgcggcaggtggtggag
ctgttggacgaggacggcttccgggtgttcgtggagtgcagcccgcaccctgtgctcgcg
gtcggcgtgcaggacaccctgcacggccgggacagcgccgccgtgctcctcggcacgctg
cgccgtgacgatggcggcctggaccgcttccgggcgagcctcgccgaggcccacctgcat
ggcgtcgaggtggactggcccgccgccctcggtgacgtcgaggtggcaccggtcgaactg
cccacctaccccttccagcacacccgccactggctggacggcccggcacgcgcgaccgac
gtgaccgctgcgggcctgaccgatccggcgcacccgctgctcgcggccggtgtcgaggtg
gccgactcgggcgcggtcgtcttcaccgcccggctctcccgcgcggccacgccgtggctc
ggtgaccacgtggtggccggcgtcgcggtcctgcccgccaccgccctggccgagatggtg
gcgaagggtggcgaggtggtggggctcgggcaggtcgacgagctgaccctgcacgcccca
gtcctggtgccggccgagggcgcggtggacctgcagctcaccgtcgggccggaggatgag
ggcggccggcggccggtgcggctccacagccgctccggggagcccggtgaggcatggcag
gtgcacggaagtggctggctgagcccggcgcatccggaaccgccctccggtgacctcacc
gcgtggcccccggtcggcgcggagccggtctccgtcgacggcctctacggggccctggcc
gaggcgggtgtcgacctcggtcccgcctttcacgggcttcgtgcggcctggaccaccgcg
gacgcgctctacgccgaggtgtccctggccgacggaatggccggagacgccagcggtcat
ctgatccatccggcgctgctcgacgcagccttgcagggcatcgccctgggcgacctgttg
ccgggcggagcggccgggcaccgcccgttctccttcaccgatctggcgttttaccggccg
gtgaccggcaccgtacgggtccggatgaccgcggccggcccggactcggtcgctgtgctg
ctggccgacgagacgggaggtccggtgtgctccatcgggtcgctcgtgctgcgtgcggcg
ccggtcgacgaggtacgggcaggcgtcgccggaacgcacgacggcctcttccggatcgac
tgggtgccggcacctccgtccgccccggcgtctgcctcgctcgccctggtcggccccgac
ccgctgcccgccggactgaacggggagcttcgccggttcccggggctcgccgagctgcgg
caggtcgtggacgccggcgagcccgtaccggatctggtcttggtggccggtgtccccgcc
gaactcgacgcggacaccgggctcgcggcgcggacgcgcgccgcgacccggcacgtgctg
gagcttatccgggcttggaccaccgacgaacggctcgcacattcgcggctcgcggtggtg
acccgcggcgcggtggcgaccggcaggcaggaggatgtgtccgacccggcggcggccgcc
gtctggggcctgctccgctcggcccacgccgagcacccggagcgcttcctggtgaccgat
gtggacgaccgagaagcgtccgcccgggcgttggtgacggccctggccggggcggaggag
cagtccgcgctccgcgacggccggctgctggtgccgaggctggcgcggctgccgcgggac
gagcccggcgctgcgcccggcgcgaccttcgacccggacggcacggtgctggtcaccggt
gcgacgggcggggtcggctcgttggtggccgagcatctcgtgaccgcgcacggcgtgcgc
cacctgttgctggtgagccgcagtggttcggccgcgccgggtgcggacctgctggtggaa
cggctgcgcgcgctcggcgcggagatcacggtcgccgcctgcgacgtcggggacgcggcc
gcactgagccggctggtgaggcaggcggaggcggatcggccgctggccgccgtggtgcac
agcgccggtgtgttcgacgacgggttgctcaccgtgctgaccgacaagcaggtggacacc
gtgtaccgggccaaggtggacgccgcggcgcacctgcacgagctcacccgggaccggccg
tcggtgccgctcgtcctcttctcctcgagcgccggcgtcttcggtggtgccggccaggcc
aactacgcggcggccaacgccttcctcgacggcctggcccaacaccggcggtcgcggggc
ctgcccggcgtcgccctggcctgggggctgtgggcggacgaacgcggcatgggcggccag
atcgacgaggcgcagcgccagcggcacgcccggcggggcatcgccgcgatgccggccgag
gacgcgttggcgctcttcgacgccgcctgccgggcgtccgaggcggcgctgctgccgatg
cggctggactggcccgccctgtacgccaaggcccgggtgaccggggttccgccgctgctg
cggaacctcgtgcgggtggcgcggcggcggaccgggaccgaccggcaggagctgcagcgg
cggctgggtgggatgggcgagcacgagcgtacgggcgcgctggtcgacctggtccgtgaa
ctcgtggcgggggtgcttggctacgagtcggcgtccgcggtggaccaggagcggccgttc
cgggacctcggcttcgactcactcaccgcggtcgagctgcgcaacctgctcaacgcggcg
accgggctgcggttgccggtgaccgtcgtcttcgaccatccgcagccgctgatgctcgcg
gagcggctcgccagcgaactcttcgccggctccgggccggagatgcccgtcggcgacccg
gaggaggagcggatccgtcgtcttgtcgcggcagtcccgatcagccggttgcggaacgcc
ggcctgctcgacgcgctgctggcgctcggcgaccccgccgcggaacaggaacgtccggcc
ggccgccgggcggagatcgaggctatggacgccgacgcgctggtgcggatggcgatggtc
gaggacagccggaggtga

DBGET integrated database retrieval system