KEGG   Mycobacterium tuberculosis 7199-99: MT7199_1277Help
Entry
MT7199_1277       CDS       T02617                                 

Definition
(GenBank) 2-HYDROXY-3-OXOADIPATE (HOA) SYNTHASE
  KO
K01616  2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MT7199_1277
Enzymes [BR:mtub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     MT7199_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh 2-oxoacid_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CCG11126
LinkDB All DBs
Position
complement(1393897..1397592)
Genome map
AA seq 1231 aa AA seqDB search
MANISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTSQPAAEPTRVTSPLV
AERAAAAAPQAPPKPADTAAAGNGVVAALAAKTAVPPPAEGDEVAVLRGAAAAVVKNMSA
SLEVPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRH
YTEVDGKPTAVTPAHTNLGLAIDLQGKDGKRSLVVAGIKRCETMRFAQFVTAYEDIVRRA
RDGKLTTEDFAGVTISLTNPGTIGTVHSVPRLMPGQGAIIGVGAMEYPAEFQGASEERIA
ELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELLLSDGFWDEVFRELSIPYLPVRWSTD
NPDSIVDKNARVMNLIAAYRNRGHLMADTDPLRLDKARFRSHPDLEVLTHGLTLWDLDRV
FKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKHVKPTVAQ
QKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMP
HRGRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLYLQMFGDNDIQVS
LTANPSHLEAVDPVLEGLVRAKQDLLDHGSIDSDGQRAFSVVPLMLHGDAAFAGQGVVAE
TLNLANLPGYRVGGTIHIIVNNQIGFTTAPEYSRSSEYCTDVAKMIGAPIFHVNGDDPEA
CVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPYVYDVVDTKRGARKSYTE
ALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHGVQPSESVESDQMIPAGLATAVD
KSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGKIDWAFGELLALGSLVAEGKLV
RLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSDGSPTGGKFLVYDSPLSEYAAV
GFEYGYTVGNPDAVVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSNVVLLLPHGHEGQ
GPDHTSARIERFLQLWAEGSMTIAMPSTPSNYFHLLRRHALDGIQRPLIVFTPKSMLRHK
AAVSEIKDFTEIKFRSVLEEPTYEDGIGDRNKVSRILLTSGKLYYELAARKAKDNRNDLA
IVRLEQLAPLPRRRLRETLDRYENVKEFFWVQEEPANQGAWPRFGLELPELLPDKLAGIK
RISRRAMSAPSSGSSKVHAVEQQEILDEAFG
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
gtggccaacataagttcaccattcgggcaaaacgaatggctggtcgaagagatgtaccgc
aagttccgcgacgacccctcctcggtcgatcccagctggcacgagttcctggttgactac
agccccgaacccacctcccaaccagctgccgaaccaacccgggttacctcgccactcgtt
gccgagcgggccgctgcggccgccccgcaggcaccccccaagccggccgacaccgcggcc
gcgggcaacggcgtggtcgccgcactggccgccaaaactgccgttcccccgccagccgaa
ggtgacgaggtagcggtgctgcgcggcgccgccgcggccgtcgtcaagaacatgtccgcg
tcgttggaggtgccgacggcgaccagcgtccgggcggtcccggccaagctactgatcgac
aaccggatcgtcatcaacaaccagttgaagcggacccgcggcggcaagatctcgttcacg
catttgctgggctacgccctggtgcaggcggtgaagaaattcccgaacatgaaccggcac
tacaccgaagtcgacggcaagcccaccgcggtcacgccggcgcacaccaatctcggcctg
gcgatcgacctgcaaggcaaggacgggaagcgttccctggtggtggccggcatcaagcgg
tgcgagaccatgcgattcgcgcagttcgtcacggcctacgaagacatcgtacgccgggcc
cgcgacggcaagctgaccactgaagactttgccggcgtgacgatttcgctgaccaatccc
ggaaccatcggcaccgtgcattcggtgccgcggctgatgcccggccagggcgccatcatc
ggcgtgggcgccatggaataccccgccgagtttcaaggcgccagcgaggaacgcatcgcc
gagctgggcatcggcaaattgatcactttgacctccacctacgaccaccgcatcatccag
ggcgcggaatcgggcgacttcctgcgcaccatccacgagttgctgctctcggatggcttc
tgggacgaggtcttccgcgaactgagcatcccatatctgccggtgcgctggagcaccgac
aaccccgactcgatcgtcgacaagaacgctcgcgtcatgaacttgatcgcggcctaccgc
aaccgcggccatctgatggccgataccgacccgctgcggttggacaaagctcggttccgc
agtcaccccgacctcgaagtgctgacccacggcctgacgctgtgggatctcgatcgggtg
ttcaaggtcgacggctttgccggtgcgcagtacaagaaactgcgcgacgtgctgggcttg
ctgcgcgatgcctactgccgccacatcggcgtggagtacgcccatatcctcgaccccgaa
caaaaggagtggctcgaacaacgggtcgagaccaagcacgtcaaacccactgtggcccaa
cagaaatacatcctcagcaagctcaacgccgccgaggcctttgaaacgttcctacagacc
aagtacgtcggccagaagcggttctcgctggaaggcgccgaaagcgtgatcccgatgatg
gacgcggcgatcgaccagtgcgctgagcacggcctcgacgaggtggtcatcgggatgccg
caccggggccggctcaacgtgctggccaacatcgtcggcaagccgtactcgcagatcttc
accgagttcgagggcaacctgaatccgtcgcaggcgcacggctccggtgacgtcaagtac
cacctgggcgccaccgggctgtacctgcagatgttcggcgacaacgacattcaggtgtcg
ctgaccgccaacccgtcgcatctggaggccgtcgacccggtgctggagggattggtgcgg
gccaagcaggatctgctcgaccacggaagcatcgacagcgacggccaacgggcgttctcg
gtggtgccgctgatgttgcatggcgatgccgcgttcgccggtcagggtgtggtcgccgag
acgctgaacctggcgaatctgccgggctaccgcgtcggcggcaccatccacatcatcgtc
aacaaccagatcggcttcaccaccgcgcccgagtattccaggtccagcgagtactgcacc
gacgtcgcaaagatgatcggggcaccgatctttcacgtcaacggcgacgacccggaggcg
tgtgtctgggtggcgcggttggcggtggacttccgacaacggttcaagaaggacgtcgtc
atcgacatgctgtgctaccgccgccgcgggcacaacgagggtgacgacccgtcgatgacc
aacccctacgtgtacgacgtcgtcgacaccaagcgcggggcccgcaaaagctacaccgaa
gccctgatcggacgtggcgacatctcgatgaaggaggccgaggacgcgctgcgcgactac
cagggccagctggaacgggtgttcaacgaagtgcgcgagctggagaagcacggtgtgcag
ccgagcgagtcggtcgagtccgaccagatgattcccgcggggctggccactgcggtggac
aagtcgctgctggcccggatcggcgatgcgttcctcgccttgccgaacggcttcaccgcg
cacccgcgagtccaaccggtgctggagaagcgccgggagatggcctatgaaggcaagatc
gactgggcctttggcgagctgctggcgctgggctcgctggtggccgaaggcaagctggtg
cgcttgtcggggcaggacagccgccgcggcaccttctcccagcggcattcggttctcatc
gaccgccacactggcgaggagttcacaccactgcagctgctggcgaccaactccgacggc
agcccgaccggcggaaagttcctggtctacgactcgccactgtcggagtacgccgccgtc
ggcttcgagtacggctacactgtgggcaatccggacgccgtggtgctctgggaggcgcag
ttcggcgacttcgtcaacggcgcgcagtcgatcatcgacgagttcatcagctccggtgag
gccaagtggggccaattgtccaacgtcgtgctgctgttaccgcacgggcacgaggggcag
ggacccgaccacacttctgcccggatcgaacgcttcttgcagttgtgggcggaaggttcg
atgaccatcgcgatgccgtcgactccgtcgaactacttccacctgctacgccggcatgcc
ctggacggcatccaacgcccgctgatcgtgttcacgcccaagtcgatgttgcgtcacaag
gccgccgtcagcgaaatcaaggacttcaccgagatcaagttccgctcagtgctggaggaa
cccacctatgaggacggcatcggagaccgcaacaaggtcagccggatcctgctgaccagt
ggcaagctgtattacgagctggccgcccgcaaggccaaggacaaccgcaatgacctcgcg
atcgtgcggcttgaacagctcgccccgctgcccaggcgtcgactgcgtgaaacgctggac
cgctacgagaacgtcaaggagttcttctgggtccaagaggaaccggccaaccagggtgcg
tggccgcgattcgggctcgaactacccgagctgctgcctgacaagttggccgggatcaag
cgaatctcgcgccgggcgatgtcagccccgtcgtcaggctcgtcgaaggtgcacgccgtc
gaacagcaggagatcctcgacgaggcgttcggctga

DBGET integrated database retrieval system