KEGG   Mycobacterium tuberculosis 7199-99: MT7199_2526Help
Entry
MT7199_2526       CDS       T02617                                 

Definition
(GenBank) putative DIHYDROLIPOAMIDE S-ACETYLTRANSFERASE E2 COMPONENT PDHC (LIPOATE ACETYLTRANSFERASE) (THIOLTRANSACETYLASE A)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00010  Glycolysis / Gluconeogenesis
mtub00020  Citrate cycle (TCA cycle)
mtub00620  Pyruvate metabolism
mtub01100  Metabolic pathways
mtub01110  Biosynthesis of secondary metabolites
mtub01120  Microbial metabolism in diverse environments
mtub01200  Carbon metabolism
Module
mtub_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MT7199_2526
   00020 Citrate cycle (TCA cycle)
    MT7199_2526
   00620 Pyruvate metabolism
    MT7199_2526
Enzymes [BR:mtub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MT7199_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: CCG12374
LinkDB All DBs
Structure
PDB: 

Position
complement(2809372..2810553)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADAAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKHNVILNSTW
VDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgttggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggtcgaaatccccagcccgtatgccggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgaaggagcggtccccacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagagttggcggtcgacctggccgcattgcagcgt
gggtcgggcgccggcggtgtgatcacccgggccgatgtgctggccgctgctcgaggcggc
gtcggagccgggccggacgtgcggccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaggtaatttgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgagattacaccgttcgcg
ctgacgctgcggctgctggttattgcattgaaacacaacgtaattctcaactcgacgtgg
gtcgactcgggcgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtggtgaccgacgcccaggacaagaacacc
cgcgaacttgcctcccgcgtagcggaattaatcaccggcgcacgtgaaggcactctcaca
cccgcggagctgcgcggttcgacgttcacggtgtcgaacttcggggcgctgggagtcgac
gacggcgtgccggtgatcaaccatcccgaagcggcgatcctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgttgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtggcccagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system