KEGG   Mycobacterium tuberculosis 7199-99: MT7199_3470Help
Entry
MT7199_3470       CDS       T02617                                 

Definition
(GenBank) ALANINE RACEMASE ALR
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mtub  Mycobacterium tuberculosis 7199-99
Pathway
mtub00473  D-Alanine metabolism
mtub01100  Metabolic pathways
mtub01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtub00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MT7199_3470
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MT7199_3470
Enzymes [BR:mtub01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MT7199_3470
Peptidoglycan biosynthesis and degradation proteins [BR:mtub01011]
 Precursor biosynthesis
  Racemase
   MT7199_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCG13318
LinkDB All DBs
Structure
PDB: 

Position
complement(3837644..3838870)
Genome map
AA seq 408 aa AA seqDB search
MKRFWENVGKPNDTTDGRGTTSLAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQ
LMAVVKADGYGHGATRVAQTALGAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDF
GPALLADVQVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALR
QAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSAT
MARPDLTFDLVRPGIAVYGLSPVPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWI
APRDTNLALLPIGYADGVFRSLGGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEG
DEAILFGPGIRGEPTAQDWADLVGTIHYEVVTSPRGRITRTYREAENR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggttctgggagaatgtcggaaagccaaacgacacgacagatgggcggggcacg
acttcgttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtg
gatctgggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcag
ctgatggcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaacc
gccctgggagccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctg
cgcgctgatggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttc
gggcccgcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaa
ctgttgcacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggatacc
gggctgaaccgcaatggcgtgggaccggcacaattcccggccatgctgaccgcgttacgc
caagccatggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgcc
gacaagcctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcg
caggcccgcgaacaaggggtgcggttcgaggtggcgcatctatcgaactcatcagcaact
atggcgcgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggcta
agcccggtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgct
gttgcgctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacatggatc
gcgccacgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccgg
tcgctgggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcgg
atctgcatggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggc
gacgaggcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggcc
gatcttgtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccagg
acctatcgcgaggctgaaaaccgttga

DBGET integrated database retrieval system