KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_01735Help
Entry
J113_01735        CDS       T02652                                 

Definition
(GenBank) fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00020  Citrate cycle (TCA cycle)
mtuc00190  Oxidative phosphorylation
mtuc00650  Butanoate metabolism
mtuc01100  Metabolic pathways
mtuc01110  Biosynthesis of secondary metabolites
mtuc01120  Microbial metabolism in diverse environments
mtuc01130  Biosynthesis of antibiotics
mtuc01200  Carbon metabolism
Module
mtuc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J113_01735
   00650 Butanoate metabolism
    J113_01735
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    J113_01735
Enzymes [BR:mtuc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     J113_01735
    1.3.5.4  fumarate reductase (quinol)
     J113_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 Fer4_16 Thioredoxin_7 Fer2_4 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AGL25713
UniProt: R4M9A6
LinkDB All DBs
Position
complement(297324..298070)
Genome map
AA seq 248 aa AA seqDB search
MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDVSFNYQKAREIPSFAPP
KELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEENKDAFAGPRFLMRIAELE
MHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGSKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacagcgcgagtatgcgggtgtggcgcggagacgaaagctgtggcgaactccgc
gaattcaccgtggaggtcaacgagggcgaggtcgtgctggacgtcatcctccgtctacaa
cagacgcagacaccggatctcgcagtgcgctggaattgcaaagctggcaagtgcggatcc
tgctcggccgagatcaacggcaaaccgcgactgatgtgcatgacgcggatgtcgacattc
gacgaggacgagatcgtcacggtcaccccaatgcggacgtttccggtgattcgcgatctt
gttaccgacgtctcgttcaactaccaaaaagcgcgcgagatcccgtctttcgcgccaccc
aaggagctacagcccagcgagtaccgaatggcgcaagtcgacgttgcacgctcgcaggag
ttccgcaagtgcattgaatgcttcctgtgccaaaacgtctgccacgtagttcgcgatcac
gaggaaaacaaggatgcgttcgccggcccccgcttcctgatgcgaatcgccgaactcgaa
atgcatccgctggacacccgggaccgacgcagccaagcacaggaagagcacggcctgggc
tactgcaatatcaccaagtgctgcaccgaagtgtgcccagaaaacatcaagatcaccgac
aatgccctgatcccgatgaaagaacgggtcgccgaccgcaagtatgatccggtggtatgg
ctgggcagcaagctgtttcgccgctaa

DBGET integrated database retrieval system