KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_13980Help
Entry
J113_13980        CDS       T02652                                 

Definition
(GenBank) phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00010  Glycolysis / Gluconeogenesis
mtuc00030  Pentose phosphate pathway
mtuc00051  Fructose and mannose metabolism
mtuc00052  Galactose metabolism
mtuc00680  Methane metabolism
mtuc01100  Metabolic pathways
mtuc01110  Biosynthesis of secondary metabolites
mtuc01120  Microbial metabolism in diverse environments
mtuc01130  Biosynthesis of antibiotics
mtuc01200  Carbon metabolism
mtuc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J113_13980
   00030 Pentose phosphate pathway
    J113_13980
   00051 Fructose and mannose metabolism
    J113_13980
   00052 Galactose metabolism
    J113_13980
  09102 Energy metabolism
   00680 Methane metabolism
    J113_13980
Enzymes [BR:mtuc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     J113_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGL27494
UniProt: R4M754
LinkDB All DBs
Position
complement(2268873..2269931)
Genome map
AA seq 352 aa AA seqDB search
MTEPAAWDEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHV
LGGCSTALFPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPG
PSLTVAEQEQCLDELRGAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSG
GGLQHISSGVFLLKASVRELRECVGSELLTEPEQLAAAHEFIDRGRAEVVVVSLGSQGAL
LATRHASHRFSSIPMTAVSGVGAGDAMVAAITVGLSRGWSLIKSVRLGNAAGAAMLLTPG
TAACNRDDVERFFELAAEPTEVGQDQTFGTRSLTRKPRHEPITQTPIDRRRY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccagcggcgtgggacgaaggcaagccgcgaatcatcactttgaccatgaac
cccgccttggacatcacgacgagcgtcgacgtggtgcgcccgaccgagaaaatgcgttgt
ggcgcacctcgctacgatcccggcggcggcggtatcaatgtcgcccgcattgtgcatgtc
ctcggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatg
gcgctgctcggtgatgcgggagtgccatttcgcgtcattccgatcgcggcctcgacgcgg
gagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcgtgcttccgggg
ccgtcgctgaccgtcgcggagcaggagcaatgcctcgacgaactgcgcggtgcggcggct
tcggccgcctttgtggtggccagtggcagcctgccgccaggtgtggctgccgactactat
cagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggatacatctggt
ggcgggttgcagcacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactg
cgcgagtgcgtcggatccgaactgctgaccgagcccgaacaactggccgccgcacacgaa
ttcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggcgcgcta
ttggccacacgacatgcgagccatcgattttcgtcgattccgatgaccgcggttagcggt
gtcggcgccggcgacgcgatggtggccgcgattaccgtgggcctcagccgtggctggtcg
ctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggc
accgcggcctgcaatcgcgacgatgtggagaggttcttcgagctggcggccgaacccacc
gaagtcgggcaggatcaaacgtttggcacccgatcgttaacccggaagcctcgccatgaa
ccaatcacacaaacccccatcgatcgtcgtcggtattga

DBGET integrated database retrieval system