KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_01175Help
Entry
J114_01175        CDS       T02653                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF5111 PAC2 DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AGL29650
LinkDB All DBs
Position
256112..257629
Genome map
AA seq 505 aa AA seqDB search
MQIRPYIGADKPAVILYPSGTVISFDELEARANRLAHWFRQAGLREDDVVAILMENNEHV
HAVMWAARRSGLYYVPINTHLTASEAAYIVDNSGAKAIVGSAALRETCHGLAEHLPGGLP
DLLMLAGGGLVGWMTYPECVADQPDTPIEDEREGDLLQYSSGTTGRPKGIKRELPHVSPD
AAPGMMPALLDFWMDADSVYLSPAPMYHTAPSVWTMSALAAGVTTVVMEKFDAEGALDAI
QRYRVTHAQFVPAMFVRMLKLPEAVRNSYDMSSLRRVIHAAAPCPVQIKEQMIHWWGPII
DEYYASSEASGSTLITAEDWLTHPGSVGKPIQGGVHIVGADGSELPPNQPGEIYFEGGYP
FEYLNDPAKTAASRNKHGWVTVGDVGYLDDDGYLFLTGRRHHMIISGGVNIYPQEAENLL
VAHPKVLDAAVFGVPDDEMGQRVMAAVQTVDSADANDQFAGELLAWLRDRLSHFKCPRSI
AFEPQLPRTDTGKLYKSGLVEKYSV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcagattcgcccgtatatcggcgccgataagcccgccgtcatcctgtatccgtccggg
acggtcatcagcttcgacgagttggaggcccgcgccaaccggttggcgcattggttccgc
caggctggtctgcgcgaggacgacgtcgtggccatcctgatggagaacaacgagcacgtg
cacgcggtcatgtgggcggctcgccgcagcgggttgtactacgtgccgatcaatacccac
ctgaccgcctccgaggccgcctacatcgtcgacaacagcggtgccaaagcaattgtcggt
tcggcggcgctgcgcgagacctgccacggcctggccgaacaccttccgggcgggctgccg
gacctgctgatgcttgccgggggcggtctggtcggctggatgacctacccggaatgcgtt
gccgatcaaccagacaccccgatcgaggacgaacgcgagggtgacctgctgcagtactcg
tcgggaacgactggccgaccgaagggaatcaaacgcgaattgccacacgtctcaccggat
gcggcacccgggatgatgccggcactgctcgatttctggatggacgccgactcggtatat
ctgagtcccgcgccgatgtaccacaccgctccgtcagtgtggacgatgagcgcactggcc
gcgggcgtcaccaccgtcgtgatggagaagttcgacgccgagggcgccctcgacgccatc
cagcgctaccgggtgacccacgcgcaattcgtcccggccatgttcgtccggatgctgaaa
ctccctgaagcagttcgtaattcgtatgacatgtccagccttaggcgagtgatccacgcg
gccgctccatgtccagtccagatcaaggagcagatgattcactggtggggaccgatcatc
gacgagtactacgcctcctcggaagccagcgggtcgacgttgatcacagccgaggattgg
ttgacgcatccgggttcggtcggcaagcccatacagggcggggtgcacatcgtgggcgcc
gacggcagcgagctgccgccgaaccagccgggcgaaatctatttcgagggcgggtacccc
ttcgaatacctcaacgatccggcgaaaaccgcggcgtcgcgcaacaagcacggctgggta
accgtcggcgacgtcggctatctcgacgacgacggctacttgttcctgaccggccggcgc
caccacatgatcatctccggcggcgtgaacatctacccgcaggaggcggagaacctcttg
gtcgcccaccccaaggtgctcgacgcggcggtgttcggcgttcccgacgacgagatgggt
caacgtgtcatggccgcggtgcaaaccgtcgactccgccgatgccaacgatcagttcgcc
ggcgagctattagcctggttacgagaccgcttgtcacacttcaagtgtccaaggtcgatc
gcgttcgaaccgcaattgccgcgcaccgacaccggaaagctctacaagagcgggctggtc
gaaaaatactcggtgtga

DBGET integrated database retrieval system