KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_06825Help
Entry
J114_06825        CDS       T02653                                 

Definition
(GenBank) Ser/Thr protein kinase
  KO
K22893  serine/threonine kinase PknH [EC:2.7.11.1]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Brite
KEGG Orthology (KO) [BR:mtue00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtue01001]
    J114_06825
Enzymes [BR:mtue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     J114_06825
Protein kinases [BR:mtue01001]
 Serine/threonine kinases: Other
  Bacterial family
   J114_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknH_C Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo FTA2
Motif
Other DBs
NCBI-ProteinID: AGL30730
LinkDB All DBs
Structure
PDB: 

Position
complement(1412381..1414261)
Genome map
AA seq 626 aa AA seqDB search
MSDAQDSRVGSMFGPYHLKRLLGRGGMGEVYEAEHTVKEWTVAVKLMTAEFSKDPVFRER
MKREARIAGRLQEPHVVPIHDYGEVDGQMFLEMRLVEGTDLDSVLKRFGPLTPPRAVAII
TQIASALDAAHADGVMHRDVKPQNILITRDDFAYLVDFGIASATTDEKLTQLGTAVGTWK
YMAPERFSNDEVTYRADIYALACVLHECLTGPPPYRADSAGTLVSSHLMGPIPQPSAIRP
GIPKAFDAVVARGMAKKPEDRYASAGDLALAAHEALSDPDQDHAADILRRSQESTLPAPP
KPVPPPTMPATAMAPRQPPAPPVTPPGVQPAPKPSYTPPAQPGPAGQRPGPTGQPSWAPN
SGPMPASGPTPTPQYYQGGGWGAPPSGGPSPWAQTPRKTNPWPLVAVAAAVVLVLVLGAI
GIWIAIRPKPVQPPQPVAEERLSALLLNSSEVNAVMGSSSMQPGKPITSMDSSPVTVSLP
DCQGALYTSQDPVYAGTGYTAINGLISSEPGDNYEHWVNQAVVAFPTADKARAFVQTSAD
KWKNCAGKTVTVTNKAKTYRWTFADVKGSPPTITVIDTQEGAEGWECQRAMSVANNVVVD
VNACGYQITNQAGQIAAKIVDKVNKE
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcacaggactcgcgggtgggctcgatgtttgggccctaccacctcaaacgg
ctgttgggccggggcgggatgggcgaggtctacgaggccgagcacaccgtcaaggagtgg
accgtcgccgtcaagctgatgaccgcggaattcagcaaggacccggtgtttcgcgagcgg
atgaaacgcgaagcccgcatcgccggccggttgcaggaacctcacgtggtgcccatccac
gactacggcgaagtcgacggccaaatgtttttggagatgcgcctggtggagggcaccgac
cttgacagcgtgctcaaacgcttcggcccgctgaccccaccgcgcgcggtggccatcatc
acccagatcgcctcggcgctcgatgccgcacacgccgacggggtgatgcaccgcgacgtc
aaaccgcaaaacattctgatcacccgcgacgactttgcctatctggtcgacttcgggatc
gccagtgcgaccaccgacgagaaactgacccagttaggcaccgcggtgggcacctggaaa
tacatggcccccgaacggttctccaacgacgaggtaacctaccgcgccgacatctacgcg
ctggcctgcgtgctgcacgaatgcttgaccgggcccccgccgtatcgcgccgacagcgcc
ggcacactggtcagctcccacctgatgggacccatcccccagcccagcgccatccgcccg
ggcatccccaaagcctttgacgcggtggtcgcccgcggcatggccaaaaagcccgaagac
cgctacgccagcgccggcgacctggccctggccgcccacgaagcgctcagcgaccccgac
caagaccacgccgccgacatcctgcgccgcagccaagaatccaccctgcccgcgccgcct
aagcccgtcccgcctccgaccatgccggccaccgccatggctcctcggcagccacccgca
ccccccgtcaccccgccgggtgtccagccggcaccaaagccgtcctacacgcccccggcc
cagccggggcctgccggacagcggcctggccccaccggccagccgtcctgggcgcccaat
agcggcccgatgccggccagcggacccactcccaccccgcagtactaccagggcggcggc
tggggcgcaccgccgtccggcggccccagcccctgggcccagaccccgcgcaaaaccaac
ccgtggcccttagtggccgtcgccgccgccgtcgtgctcgtcctcgtgttgggcgccatc
ggcatctggatcgccatccggcccaagccggtacagccgcctcagccggttgcggaggag
cgccttagcgccctactgctgaactcctcagaagtcaacgccgtgatgggctcgtcgtcc
atgcagccgggcaaaccgatcacatcgatggactcttcgccggtgacggtgtccctgccg
gactgccagggcgcgctgtataccagccaggatccggtgtatgccggcaccggctacacc
gccatcaacggcttgatttcatccgagccgggcgacaactacgaacattgggtgaaccaa
gccgtcgtcgcctttccgaccgccgacaaagcccgcgcgttcgtgcagacttcggccgac
aaatggaagaactgcgcaggcaagacggtcaccgtcacgaataaggccaagacctaccgg
tggacgtttgccgacgtcaaaggcagcccgccgacgatcacggtgatagacacccaagaa
ggcgctgagggctgggaatgccaacgcgcgatgagcgtggccaacaatgtggtcgtcgac
gtcaacgcatgcgggtaccagatcaccaatcaagcaggccagatcgccgccaagatcgtt
gacaaagtcaacaaggaatga

DBGET integrated database retrieval system