KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_17440Help
Entry
J114_17440        CDS       T02653                                 

Definition
(GenBank) cationic amino acid transport integral membrane protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Brite
KEGG Orthology (KO) [BR:mtue00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    J114_17440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C PrgI
Motif
Other DBs
NCBI-ProteinID: AGL32765
LinkDB All DBs
Position
complement(3615107..3616594)
Genome map
AA seq 495 aa AA seqDB search
MAGRRRMKSVEQSIADTDEPTTRLRKDLTWWDLVVFGVSVVIGAGIFTVTASTAGDITGP
AIWISFLIAAATCALAALCYAEFASTLPVAGSAYTFSYATFGEFLAWVIGWNLVLELAMG
AAVVAKGWSSYLGTVFGFGNGTGHLGSLQLDWGALVIVTLVATLIALGTKLSSRFSAVVT
AIKVSVVVLVAVVGAFYIRAANYSPFIPEPEVQHHGGGLDQSVFSLLTGAQGSHYGWYGV
LAGASIVFFAFIGFDIVATMAEETKRPQRDVPRGILASLGVVTLLYVAVSVVLSGMVPYT
QLRTVPGRGPANLATAFQANGVYWASGIISVGALAGLTTVVMVLMLGQCRVLFAMARDGL
VPRQLAKTGSRGTPVRVTVLVAVLVATTASVFPITKLEEMVNVGTLFAFILVSAGVVVLR
RTRPDLQRGFTAPWVPLLPIAAVCACLWLMLNLTALTWIRFGIWLVAGTAIYVGYGRRHS
AQGLRQARESATRRC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcgacggcgcatgaagtcggtagaacagtcaatcgccgacaccgacgagccc
accactcggctgcgcaaggacctcacctggtgggacctggttgttttcggcgtctcggtg
gtgattggcgccggaatattcacggttaccgcgtcgaccgctggcgatatcaccggcccg
gccatctggatatcgtttctgatcgcggcggcgacctgtgcgctggccgcgctgtgctac
gccgagttcgcctcgacgctgccggtggccggcagcgcctataccttctcttatgccacc
ttcggggagttcttggcctgggtgatcggctggaatctggtgctggaactggcgatgggt
gcggccgtggtcgccaaaggctggtccagctacttgggcaccgtgttcggattcggtaat
ggcacaggccatctcggatcgctgcagctcgactggggtgcgctcgtgatcgtcacgttg
gtggcgaccctgatcgcgttgggcaccaaattgtcgtcgagattttccgcggtggtcacc
gcaatcaaggtgtcggtggtcgtcttggtggcggtcgtcggtgccttctacatcagggcc
gccaactactcgccgttcattcccgagcccgaagtccagcaccacggcggcgggctcgat
caatccgtcttctcgttgctgaccggagcccaaggcagccactacggatggtacggcgtg
ctggccggggcatcgatcgtgttcttcgcgtttatcgggtttgacatcgtggccaccatg
gccgaggagaccaagcgtcctcaacgagacgtccctcgagggattctcgcgtcgctgggg
gtcgtgacccttctctacgtcgcggtatcggtggtgctgtcgggcatggttccatacacc
caactgcggaccgtaccgggccgcgggccggcaaatctggccaccgcgttccaggccaac
ggggtgtactgggccagcggcatcatctccgtcggcgcgctggccgggcttaccacggtg
gtgatggtgttgatgctcgggcaatgccgcgtgctgttcgccatggcgcgcgacggcttg
gtgccgcggcaattggccaagaccggttcgcgcggcaccccggtccgggtcacggtgctg
gtcgcggtgttggtggccacgacggcgtcggtgtttccgatcaccaagcttgaggagatg
gtcaacgtcgggacactgttcgcgttcatcctcgtctcggccggagtggtcgtgctgcgc
cggacccgacccgaccttcagcgggggttcacagctccgtgggtgccgttacttccgatc
gccgcagtgtgcgcgtgcctgtggctgatgctgaacctcaccgcgttgacttggatccgg
ttcgggatctggctggtggccggaaccgcgatttatgtcggctacgggcgccggcactcg
gcgcagggccttcggcaagctcgagagagcgcgacccggaggtgttga

DBGET integrated database retrieval system