KEGG   Mycobacterium tuberculosis EAI5/NITR206: J114_18395Help
Entry
J114_18395        CDS       T02653                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mtue  Mycobacterium tuberculosis EAI5/NITR206
Pathway
mtue00250  Alanine, aspartate and glutamate metabolism
mtue00410  beta-Alanine metabolism
mtue00430  Taurine and hypotaurine metabolism
mtue00650  Butanoate metabolism
mtue01100  Metabolic pathways
mtue01110  Biosynthesis of secondary metabolites
mtue01120  Microbial metabolism in diverse environments
mtue02024  Quorum sensing
Module
mtue_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    J114_18395
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    J114_18395
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    J114_18395
   00430 Taurine and hypotaurine metabolism
    J114_18395
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    J114_18395
Enzymes [BR:mtue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     J114_18395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGL32944
LinkDB All DBs
Position
complement(3830625..3832007)
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPVPALRMPDESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEGLRDHDPTSA
TGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMPNLVMGSNVQVVWEKFCRYFDVEPRS
LPMERGRYVITPEQVLAAVDENTIGVVAILGTTYTGELEPIAETCAALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPEDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLRE
VDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHELRTFGWQVPAYTMPDNATDVAVLRIV
VREGLSADLARALHDDAVTALAALDKVKPGGHFDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcgcagtcacccgtccgtgcccgcgcattcgatcgctccggcctacaccggtcgg
atgttcaccgcaccggtgccggcgctgcggatgcccgatgagtcgatggatcccgaggcg
gcctatcgcttcatccacgacgagctgatgctcgacggtagctcgcggctgaatctggcc
accttcgtgaccacctggatggacccggaggccgaaaagctgatggccgagacgttcgac
aagaacatgatcgataaggacgaatacccggcgaccgcggccatcgaggcgcgctgtgtg
tccatggtcgccgacctgtttcacgccgagggtctgcgcgaccacgaccccaccagcgcc
accggggtgtccaccatcggctccagcgaggcggtgatgctgggtgggctggccctgaaa
tggcgttggcggcaacgggtggggtcttggaaggggcgcatgcccaatctggtgatgggt
tcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgttcc
ctgccgatggagcggggccgctacgtcatcacccccgagcaggtgctcgccgccgtcgac
gagaacaccatcggcgtggtggcgatcttgggcaccacctataccggtgaactcgaaccc
atcgccgagacctgcgccgcgctggacaaactggcggctggcgggggtgtggacgtcccg
gtacacgtcgacgcggccagtgggggctttgtggtgccgtttttgcatccggacctggta
tgggattttcggctgccccgcgtggtgtcgatcaacgtcagcggccacaagtatgggctg
acctatcccggcgtcgggtttgtcgtgtggcgcgggcccgagcacctgccggaggatctg
gttttccgggtcaactacctcggcggcgacatgccgaccttcaccctgaacttctcccgt
cccggtaaccaggtggtgggccagtactacaacttcctgcggctggggcgcgacggctat
accaaggtgatgcaggcgctgtcgcacaccgcccggtggctgggtgaccagctgcgcgag
gtggatcattgcgaggtgatctcggatggttcggcgatcccggtggtcagcttccggctc
gccggcgaccgcgggtacacggagttcgacgtctcccatgagctgcggaccttcgggtgg
caggtgcccgcctacaccatgccggacaacgccaccgacgtggcggtgctgcggatcgtg
gttcgggaaggactctccgccgacctggcgcgggccctgcacgacgacgcggtcaccgcg
ttggctgccctggacaaggtcaagccgggtggccacttcgacgcacagcatttcgcgcac
tag

DBGET integrated database retrieval system