KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_01780Help
Entry
I917_01780        CDS       T02654                                 

Definition
(GenBank) fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00020  Citrate cycle (TCA cycle)
mtuh00190  Oxidative phosphorylation
mtuh00650  Butanoate metabolism
mtuh01100  Metabolic pathways
mtuh01110  Biosynthesis of secondary metabolites
mtuh01120  Microbial metabolism in diverse environments
mtuh01130  Biosynthesis of antibiotics
mtuh01200  Carbon metabolism
Module
mtuh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I917_01780
   00650 Butanoate metabolism
    I917_01780
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I917_01780
Enzymes [BR:mtuh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I917_01780
    1.3.5.4  fumarate reductase (quinol)
     I917_01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 Fer4_16 Thioredoxin_7 Fer2_4 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AGL22018
UniProt: R4LYJ7
LinkDB All DBs
Position
complement(298746..299492)
Genome map
AA seq 248 aa AA seqDB search
MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDVSFNYQKAREIPSFAPP
KELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEENKDAFAGPRFLMRIAELE
MHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGSKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacagcgcgagtatgcgggtgtggcgcggagacgaaagctgtggcgaactccgc
gaattcaccgtggaggtcaacgagggcgaggtcgtgctggacgtcatcctccgtctacaa
cagacgcagacaccggatctcgcagtgcgctggaattgcaaagctggcaagtgcggatcc
tgctcggccgagatcaacggcaaaccgcgactgatgtgcatgacgcggatgtcgacattc
gacgaggacgagatcgtcacggtcaccccaatgcggacgtttccggtgattcgcgatctt
gttaccgacgtctcgttcaactaccaaaaagcgcgcgagatcccgtctttcgcgccaccc
aaggagctacagcccagcgagtaccgaatggcgcaagtcgacgttgcacgctcgcaggag
ttccgcaagtgcattgaatgcttcctgtgccaaaacgtctgccacgtagttcgcgatcac
gaggaaaacaaggatgcgttcgccggcccccgcttcctgatgcgaatcgccgaactcgaa
atgcatccgctggacacccgggaccgacgcagccaagcacaggaagagcacggcctgggc
tactgcaatatcaccaagtgctgcaccgaagtgtgcccagaaaacatcaagatcaccgac
aatgccctgatcccgatgaaagaacgggtcgccgaccgcaagtatgatccggtggtatgg
ctgggsagcaagctgtttcgccgctaa

DBGET integrated database retrieval system