KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_01785Help
Entry
I917_01785        CDS       T02654                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00020  Citrate cycle (TCA cycle)
mtuh00190  Oxidative phosphorylation
mtuh00650  Butanoate metabolism
mtuh01100  Metabolic pathways
mtuh01110  Biosynthesis of secondary metabolites
mtuh01120  Microbial metabolism in diverse environments
mtuh01130  Biosynthesis of antibiotics
mtuh01200  Carbon metabolism
Module
mtuh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I917_01785 (sdhA)
   00650 Butanoate metabolism
    I917_01785 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I917_01785 (sdhA)
Enzymes [BR:mtuh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I917_01785 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     I917_01785 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AGL22019
UniProt: R4LRK6
LinkDB All DBs
Position
complement(299493..301433)
Genome map
AA seq 646 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD
QGAIAGAFGYWRXSGRXIVFEAPAVVLATGGXGKXFKXTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQXAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR
LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAEAXDAAAQQALSPXEGPKDGSA
PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWSRYHNVLVEGHRQYNPGWNLS
IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRRILLVCRATETMGTGGSGSG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgagcggcactcctacgacgtagtcgtgatcggtgccggcggcgcgggg
ttacgcgcggtcatcgaggcgcgggaacgcggcttgaaagtagccgtcgtgtgcaaatcc
ctattcggcaaggcccacacggtcatggccgaaggcggctgcgcggccgcgatgggcaac
gccaacccgaaggacaattggaagactcacttcggcgacacgatgcgcggtggaaagttc
ctgaacaactggcgtatggccgagctgcacgccaaggaggcgccggaccgggtctgggag
ttggagacctacggcgcgctgttcgaccgcaccgacgatggccgaatcagtcagcgcaac
ttcggcggacacacctatccgcgactggcgcacgtcggcgaccgcaccggcctggagttg
atccgcaccctgcagcaaaaggttgtctcgctgcagcaggaggaccacgccgagctcggc
gactacgaagcgcggatcaaagtgttcgccgaatgcaccatcaccgaactgctcaaggac
caaggcgcgatcgccggagccttcggctactggcgggraagcggccggktcatcgtgttc
gaggcgccagcggtggtgcttgccactggcgggrkcggsaagkcgttcaaggkgacatcc
aactcctgggagtacaccggagacgggcacgcgttggcactgcgggccggggcgacgctg
atcaacatggagttcgtccagttccacccgacgggcatggtgtggccgcccagtgtcaag
ggaattctggtcactgagggtgttcgcggcgacggcggagtgctcaaaaactcggagaac
tctcgcttcatgttcgactacattccgccggtgttcaagggccagtasgccgagacggag
gaagaggccgaccagtggcttaaggacaacgactcggcccgacgcaccccggacttgctg
ccccgcgacgaggtcgcgcgcgcgatcaactcagaggtcaaggccggccgcggtaccccg
cacggcggcgtctacctcgacatcgcatcccggctgacacccgccgagatcaaacggcga
ttgccgtcgatgtatcaccagttcaaagagctcgctgaagtcgatatcacaacgcaggca
atggaagtcgggccgacgtgtcactacgtgatgggcggtgtcgaagtagacgcggacacc
ggcgccgccacggtgccaggcctgttcgctgccggtgagtgtgccggcggtatgcacggc
tccaaccggctgggcggcaattcgctgtccgatctgctggtattcggccggcgggccggc
ctgggcgcagcggattacgtacgggcactgagcagccggccagcggtttcagcggaggct
aycgatgcggcggcccarcargcgctgagccccytcgaaggaccgaaagacggctcggcg
ccggagaatccgtacgcgctgcatatggacttgcagtacgtgatgaacgatctggtcggt
atcatccgcaacgccgacgaaatatccagggcgctgactcttttggccgagctgtggtcg
cgctaccacaacgtactcgtcgaaggtcaccgtcaatacaatccgggctggaacctgtcc
atcgacctgcgcaacatgttgctggtcagcgagtgcgtggccagagctgcgctacagcgc
accgaaagccgaggcggccacacccgagacgaccatcccggtatggaccccaactggcgc
aggatcttgctggtatgccgggccaccgaaaccatgggcaccggtggcagcgggtccggc
gactccaactgccacatcaacgtcacccagcagctgcaaacgcccatgcgacccgacttg
ctggagctcttcgagatctcggagttggagaaatactacaccgacgaagagctggccgag
catccaggacggagaggctaa

DBGET integrated database retrieval system