KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_06615Help
Entry
I917_06615        CDS       T02654                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    I917_06615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtuh03400]
    I917_06615
Enzymes [BR:mtuh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     I917_06615
DNA repair and recombination proteins [BR:mtuh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     I917_06615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGL22654
UniProt: R4LTB9
LinkDB All DBs
Structure
PDB: 

Position
1049498..1050739
Genome map
AA seq 413 aa AA seqDB search
MLVSWAVPKNLPDNTSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEK
FHDDPHTGEVIVNLHGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHG
TVAGLKASQWAFEGKWDGYRLLVEADHGAVRLRXRSGRDVTAEYPQLRALAEDLADHHVV
LDGEAVVLDSSGVPSFSQMQNRGXDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLEXLAN
ATSLTVPELLPGDGAQXFACSRKHGWEGVIAKRRDSRYQPGRRCASXVKDKHWNTQEVVI
GGWRAGEGGRSSGVGSLLMGIPGPXGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFD
VPLPARDAKGITYVKPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtctcgtgggcggtaccgaaaaacctgcccgacaacacatcggttaaccatcta
gcgatacacaccgaggaccacccgctggaatacgccacgttcgagggcgcgattcccagc
ggggagtacggcgccggcaaggtgatcatctgggactccggcacttacgacaccgagaag
ttccacgatgacccgcacacgggggaggtcatcgtgaatctgcacggcggccggatctct
gggcgttatgcgctgattcggaccaacggcgatcggtggctggcgcaccgcctaaagaat
cagaaagaccagaaggtgttcgagttcgacaatctggccccaatgcttgccacgcacggc
acggtggccggtctaaaggccagccagtgggcgttcgaaggcaagtgggacggctaccgg
ttgctggttgaggctgaccacggcgccgtgcggctgcggkcccgcagcgggcgcgatgtc
accgccgagtatccgcaattgcgggcattggcggaggatctcgccgatcaccacgtggtg
ctggacggcgaggccgtcgtacttgactcctctggtgtgcccagcttcagccagatgcag
aatcggggcckcgacacccgtgtcgagttctgggcgttcgacctgctctacctcgacggc
cgcgcgctgctaggcacccgctaccaagaccggcgtaagctgctcgaamccctagctaac
gcaaccagtctcaccgttcccgagctgctgcccggtgacggcgcccaagsgtttgcgtgc
tcgcgcaagcacggctgggagggcgtgatcgccaagaggcgtgactcgcgctatcagccg
ggccggcgctgcgcgtcgtrggtcaaggacaagcactggaacacccaggaagtcgtcatt
ggtggctggcgcgccggggaaggcgggcgcagcagtggcgtcgggtcgctgctcatgggc
atccccggtccagktgggctgcagttcgccgggcgggtcggtaccggcctcagcgaacgc
gaactggccaacctcaaggagatgctggcgccgctgcataccgacgagtcccccttcgac
gtaccactgcccgcgcgtgacgccaagggcatcacatatgtcaagccggcgctggttgca
gaggtgcgctacagcgagtggactccggagggccggctgcgtcaatcaagctggcgtggg
ctgcggccggacaagaaacccagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system