KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_20930Help
Entry
I917_20930        CDS       T02654                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00473  D-Alanine metabolism
mtuh00550  Peptidoglycan biosynthesis
mtuh01100  Metabolic pathways
mtuh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    I917_20930 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I917_20930 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    I917_20930 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtuh01011]
    I917_20930 (ddl)
Enzymes [BR:mtuh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     I917_20930 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mtuh01011]
 Precursor biosynthesis
  Amino acid ligase
   I917_20930 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGL24557
UniProt: R4MAN5
LinkDB All DBs
Structure
PDB: 

Position
complement(3333140..3334177)
Genome map
AA seq 345 aa AA seqDB search
MSAGSILRNLDSRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQVKSGSGTELALPA
DPRRGGQLVSLPPGAGEVLESVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAV
GMDKEFTKKLLAADGLPVGAYAVLRPPRSTLHRQECERLGLPVFVKPARGGSSIGVSRVS
SWDQLPAAVARARRHDPKVIVEAAISGRELECGVLEMPDGTLEASTLGEIRVAGVRGRED
SFYDFATKYLDDAAELDVPAKVDDQVAEAIRQLAIRAFAAIDCRGLARVDFFLTDDGPVI
NEINTMPGFTTISMYPRMWAASGVDYPTLLATMIETALARGVXLH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgccggcagcatcctgcgcaacctggactcgcggcggttcgacgtgatcgcggtg
ggtatcaccccggcaggttcgtgggtgctcaccgacgccaaccccgacgccctgacgatc
accaaccgggagcttcctcaggtcaaatcaggatcgggcaccgagctggcgctgccggcc
gatccgcggcgtggtggccagttggtgtcgctgccgcccggggccggcgaggttctggag
tcggtcgacgtggtgttcccggtactgcacggcccgtacggcgaggacggcacgatccag
ggactgctcgaactcgccggggtgccctacgtgggcgccggtgtgctggccagtgccgtc
ggcatggacaaggagttcaccaagaagctgctcgccgccgatggacttccggtgggtgcg
tacgcggtgctgcgtccgccgcggtcgacactgcaccgccaggagtgcgaacggctgggc
ttaccggtgttcgtcaaacccgcccgaggcggctcgtcgatcggtgttagccgggtgtcg
agttgggatcaactgcccgccgcggtcgcgcgggcccgccggcatgaccctaaggtcatc
gtcgaggccgcgatcagcggccgcgagctggaatgcggtgtgctygaaatgccggacggc
acactggaagccagcacgctgggggagatccgggtggccggggtgcggggacgcgaggac
tctttctacgacttcgcaaccaagtatctcgacgacgcagccgaattggacgtgcccgcc
aaggtcgatgaccaggtcgcagaggcgattcgtcagctggcgatccgggcgttcgcggct
atcgactgccggggtctggccagggtggacttcttcctcaccgacgacggtccggtgatc
aacgagatcaacacgatgccgggattcaccacgatctcgatgtacccgcggatgtgggcg
gccagcggtgtcgactatccgaccctgctggcgacgatgatcgagacggcattggcccgc
ggcgtgkgcctgcactag

DBGET integrated database retrieval system