KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_23345Help
Entry
I917_23345        CDS       T02654                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00020  Citrate cycle (TCA cycle)
mtuh00190  Oxidative phosphorylation
mtuh00650  Butanoate metabolism
mtuh01100  Metabolic pathways
mtuh01110  Biosynthesis of secondary metabolites
mtuh01120  Microbial metabolism in diverse environments
mtuh01130  Biosynthesis of antibiotics
mtuh01200  Carbon metabolism
Module
mtuh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I917_23345 (sdhB)
   00650 Butanoate metabolism
    I917_23345 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I917_23345 (sdhB)
Enzymes [BR:mtuh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I917_23345 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     I917_23345 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_8
Motif
Other DBs
NCBI-ProteinID: AGL24881
UniProt: R4MAF6
LinkDB All DBs
Position
3701840..3702070
Genome map
AA seq 76 aa AA seqDB search
MFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRXRTTFNCTESCPRGIE
VTKAIQEVKRALMFTR
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
gtgttctggcacgagggcagctacttcggcccggcggcgatcgtcaacgcgcaccgcttc
atcttcgacagccgcgacgaggccgccgccgagcgcctcgacatcctcaacgaggtcgac
ggggtgtggcgckgccgcaccacgttcaactgcaccgaatcctgcccacggggcattgag
gtgaccaaggcgatccaggaggtcaagcgcgcgctgatgttcacccgctga

DBGET integrated database retrieval system