KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26200Help
Entry
I917_26200        CDS       T02654                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGL25277
UniProt: R4MCQ9
LinkDB All DBs
Position
4174621..4175667
Genome map
AA seq 348 aa AA seqDB search
MIXSNWXSRNERPMTRYFPELVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAE
SRVRMLADRTPASFIAFDLLALGDDDYTGRPFSXRXAALVDAVTGSGADADLSIHVTPAT
TDMATAQRWFSEFEGAGLDGVIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGS
DAIGSLLLGLYQEDGQLASVGVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAXHVAGQR
TPRKNEFSRWNVGKDLSFVPLRPERVVEVRYDHMEGARFRHTAQFNRWRTRPRPTLMQLC
PARTPAHRQPLRHCAGPTLRCDPLRSVDPRWADRLGRXIRVGSLRSAA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgatcrggtcraactggkttagccgcaacgagcggccgatgacccgctacttccccgag
ctggtcgccgcgatcagggccgagctgccgcatcgctgtgtgatcgacggggagatcatc
atcgccaccgaccacggcttggacttcgaggcgctgcaacagcgcatccaycctgccgag
tcgagggtgcgaatgcttgccgaccgcacaccagcctccttcatcgcattcgacctgctg
gccctcggcgacgacgactacaccgggcgaccgttcagcraaagrsgagccgctctggtc
gatgccgtaactggttcgggggccgacgctgacctgtcgatccacgtcaccccggcaacc
accgacatggcgaccgcacaacgatggttctccgagttcgagggggccggtctagacggt
gtcatcgccaaaccgccgcacatcacctatcaaccggacaaacgcgttatgttcaagatc
aaacacctgcggaccgccgattgcgtggtggccggctaccgggtgcacaagtccggcagt
gacgcgatcggctcactgctgctagggctttaccaggaggacggccaactcgcgtcggtc
ggcgtgatcggcgcgttccccatggccgaacgacgccggctattaaccgagctgcagccg
ctggtcaccagcttcgacgaccacccatggaactgggccrmccacgttgccggccagcgc
accccacgtaagaacgagttctcccgctggaatgtcggcaaagacctgtcgttcgtgccg
ctgcgacccgagcgggtggtcgaggtccgctacgaccacatggaaggcgcgcggttccgc
cacaccgcacagttcaaccggtggcgcacccgaccgcgacccacgctcatgcagctatgc
ccagctcgaacgcccgctcaccgtcagcctctccgacattgtgccgggcctacgctaagg
tgcgaccctcttcggtcagttgatccccggtgggccgatcggctcgggcgccmcatccgg
gtcggttcgttgcgttcggccgcgtaa

DBGET integrated database retrieval system