KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26300Help
Entry
I917_26300        CDS       T02654                                 

Definition
(GenBank) hypothetical protein
  KO
K09966  uncharacterized protein
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    I917_26300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2237
Motif
Other DBs
NCBI-ProteinID: AGL25284
UniProt: R4M0X0
LinkDB All DBs
Position
complement(4188649..4188846)
Genome map
AA seq 65 aa AA seqDB search
MLGGALEQGGTDPLTGFYRDGCCATGPEDLGWHTICAVMTTEFLAHQRSVGNDLSIARPP
RWLRP
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggcggcgccctggaacagggtggcaccgatccgcttaccggcttctatcgtgac
ggctgctgtgcgaccggacccgaggacctcggttggcacaccatctgcgccgtcatgacc
accgaattcctggcacaccagcgctcggtcggcaacgacctgtcgattgcgcgcccgcca
cggtggctgcgcccttga

DBGET integrated database retrieval system