KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26450Help
Entry
I917_26450        CDS       T02654                                 

Definition
(GenBank) hypothetical protein
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 SnoaL DUF4440 HCBP_related SnoaL_3 LEH
Motif
Other DBs
NCBI-ProteinID: AGL25304
UniProt: R4M0Y9
LinkDB All DBs
Position
4206865..4207224
Genome map
AA seq 119 aa AA seqDB search
MGSTPPRTPQEVFAHHGQALAAGDLDEIVADYADDSFVITPAGIARGKEGIRQLFVKLLD
DIPNALWDLKTQIFEGDILFLEWTANSAVSRVDDGVDTFVFRDGTIWAHTVRYTPHPKT
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggggtccacgccgccacgtacgccgcaggaggtattcgcccaccacggccaggcgctc
gccgcgggcgacctcgatgagatcgtcgccgactacgccgacgactcctttgtcatcact
ccggccggtatcgcgcgcggcaaggaaggtattcgccaactgttcgtcaagttgctcgac
gacataccaaacgcactgtgggacttaaagacccaaatcttcgagggcgacatactgttc
ctggagtggaccgcgaattccgcggtcagccgagtcgacgacggagtcgatactttcgta
ttccgagacggcacgatctgggcgcataccgtccggtacaccccgcaccccaagacctga

DBGET integrated database retrieval system