KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26490Help
Entry
I917_26490        CDS       T02654                                 

Definition
(GenBank) aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00340  Histidine metabolism
mtuh00350  Tyrosine metabolism
mtuh00360  Phenylalanine metabolism
mtuh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtuh00401  Novobiocin biosynthesis
mtuh01100  Metabolic pathways
mtuh01110  Biosynthesis of secondary metabolites
mtuh01130  Biosynthesis of antibiotics
mtuh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    I917_26490
   00350 Tyrosine metabolism
    I917_26490
   00360 Phenylalanine metabolism
    I917_26490
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    I917_26490
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    I917_26490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtuh01007]
    I917_26490
Enzymes [BR:mtuh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     I917_26490
Amino acid related enzymes [BR:mtuh01007]
 Aminotransferase (transaminase)
  Class II
   I917_26490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGL25312
UniProt: R4MCU6
LinkDB All DBs
Structure
PDB: 

Position
4210252..4211007
Genome map
AA seq 251 aa AA seqDB search
MVFGWXSFXLXPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTV
VGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLA
GLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLXAADELLARTDTVVAERARVSA
ELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAF
LRFARRWRSDQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtggtcttcggctggsgcagctttkagctctwtccaccacaggtccgggtcgccggcgct
atccccatccaggtgccgttgaccgaccacacgttcgacctctacgccatgctcgccacg
gtcaccgaccgcacccggctgatcttcgtgtgcaaccccaacaatccgacctccaccgtc
gtcggtccggacgcgctggcccgcttcgtcgaggcggttccggcgcacatcctgatcgcc
atcgacgaggcgtatgtggagtacatccgggacggcatgcggcccgacagcttaggcctg
gttcgcgcacacaacaatgtcgttgtgctgcgtacgttttcgaaagcgtacggcctggcg
gggttgcggatcggctacgcgatcggccaccccgacgtcataaccgcgctggacaaggtc
tacgtgccatttaccgtgtcgagtatcgggcaggccgcggccatcgcgtccctggmcgcc
gccgacgagctgctggcccgtaccgacaccgtggttgccgagcgcgcccgcgtcagcgcc
gagttgcgtgctgccgggttcacgctgccgccatcgcaggccaactttgtctggcttccg
ctgggatcccgcacccaagacttcgtggagcaggccgccgatgcacgcatcgtggtccgc
ccgtacggcacggatggcgttcgggtcaccgtcgccgcaccagaggagaacgacgcgttc
ctgcggttcgcccgccgctggcggagcgaccaatga

DBGET integrated database retrieval system