KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26580Help
Entry
I917_26580        CDS       T02654                                 

Definition
(GenBank) hypothetical protein
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 NmrA adh_short
Motif
Other DBs
NCBI-ProteinID: AGL25323
UniProt: R4M861
LinkDB All DBs
Position
4223101..4225386
Genome map
AA seq 761 aa AA seqDB search
MEILVTGGAGFQGSHLTESLLANGHWVTVLDKSSRNAVRNMQGFRSHDRAAFISGSVTDG
QTIDRAVRDHHVVFHLAAHVNVDQSLGDPESFLETNVMGTYRVLEAVRRYRNRLIYVSTC
EVYGDGHNLKEGERLDEHAELKPNSPYGASKAAADRLCYSYFRSYGLDVTIVRPFNIFGV
RQKAGRFGALIPRLVRQGINGEGLTIFGAGSATRDYLYVSDIVGAYNLVLRTPTLRGQAI
NFASGKDTRVRDIVEYVADKFGARIEHRDARPGEVQRFPADISLAKSIGXQPQVEIWDGI
DRYINWAKDQPQYPYEQDGFSGSSVSLIXPXPPSSAGKVGRNGAELPAGRITSHSMVTVA
RRPVCPVTLTPGDPALASVXDLVDAWSAHDALAELVTMFGGAFPQTDHLEARLASLDKFS
TAWDYRARARAARALHGEPVRCQDSGGGARWLIPRLDLPAKKRDAIVGLAQQLGXTLEST
PQGTTFDHVLVIGTGRHSNLIRARWARELAKGRQVGHIVLAAASRRLLPSEDDAVAVCAP
GARTEFELLAAAARDAFGLDVHPAVRYVRQRDDNPHRDSMVWRFAADTNDLGVPITLLEA
PSPEPDSSRATSADTFTFTAHTLGMQDSTCLLVTGQPFVPYQNFDALRTLALPFGIQVET
VGFGIDRYDGLGELDQQXPAKLLQEVRSTIRAARALLERMXGRRXHGYRSSAVMXCXXWX
XGSCPIRLXTXPGGGHGRSPMLARYRTGLTCPSCVRTSKCR
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacttgtcaccgggggcgcgggcttccagggaagccatctgaccgagtcactg
ctggccaatgggcattgggtcactgtcctcgacaagtcttcgaggaatgcggttcgtaac
atgcagggatttcgttcgcatgaccgcgccgcgttcatatccggttcggtaaccgacggc
cagacgatcgaccgcgcggtgcgggaccatcacgtcgtatttcacctggccgcgcatgtc
aacgtggaccagtccttgggcgacccggagagctttctcgaaaccaatgtcatgggaacc
taccgcgtcctggaagccgtccggcgctacaggaaccgcttgatatacgtatcgacgtgc
gaagtctacggcgacggacacaatctcaaggaaggcgaacgacttgacgaacacgcggag
ctgaagccgaacagtccatatggcgcttccaaggcggcggccgaccgcttgtgctactcg
tactttcgctcctacggactcgacgtcacgatcgtccgtccgttcaacatcttcggcgtc
cgccaaaaggctgggcgattcggcgcgctgattccgcggctggtccgccagggcatcaac
ggtgaaggcctgacaatcttcggcgcaggtagcgcaacccgggattacctgtatgtcagt
gacatcgtgggcgcgtacaacctggtattacgaactccaaccctgcgtggtcaggccatc
aattttgccagcgggaaagatacccgggtgagggacatcgtcgagtatgttgcggacaag
ttcggtgccaggatcgagcaccgcgacgctcgccccggagaggtccagcgctttcccgct
gacatttcgcttgccaaaagcatcgggtyccagccgcaagtcgaaatttgggacggcatc
gatcgctatatcaattgggccaaggatcagccccaatacccatatgagcaggacgggttt
agcggttccagcgtttctctaatacmcccgycgccgccatcgtctgccggtaaagtgggc
cgaaatggcgcggaactaccagctggaaggattacctcccattcgatggtgaccgtagca
cgccgaccggtgtgcccggtgacgctgacaccgggtgacccggcgctagcgtcggtgcsc
gacctggtcgacgcgtggagcgcgcatgatgcgctggcagagctggtcacgatgttcggc
ggcgcgtttccgcagacggaccatctggaagcgcggctggcgagcctggacaagttcagc
acggcatgggactaccgggcgcgcgcacgtgcagcacgagcgctccacggcgaaccggtg
cggtgccaggactccggcggtggggcgcgatggctgatcccccgcctggacttgccggcc
aagaagcgggacgcgatcgtcgggttggcgcagcagctggggstcaccttggaatcgacc
ccgcagggaacaaccttcgaccacgttctagtcatcggcaccggacgtcattccaacctg
atccgggcccgctgggcccgggaattggcaaagggtcgccaggttggtcacatcgtgctc
gccgccgcatcgcgtcgattgctgccctccgaggatgacgcggtcgcggtctgtgcgccg
ggcgcacgcaccgaattcgagctattagcggccgcggcaagggacgcattcggcctggac
gtccacccagcggtgcggtatgtgcgccagcgggacgacaacccgcaccgggacagcatg
gtgtggcgcttcgccgccgacaccaatgacctaggcgttccgatcaccctgctggaggcg
ccatcgccggagcccgacagcagccgcgccacctcggccgacaccttcacgtttaccgca
cacacgctgggtatgcaggactcaacgtgtctgttggtgaccgggcaaccgttcgtgccc
taccagaacttcgacgcactgcgaactctggcgctgcccttcgggatacaggtggagaca
gtgggcttcggcatcgaccgctacgacgggctgggtgagttggaccaacaacmccctgcm
aagctgctgcaggaggtccgctcgacgatccgagcggcccgagccctgctggaacggatg
csaggccggcgagmrcayggctaccgatcctcggcggtgatgrcctgcatsgmgtggcsg
gsgggtagctgcccgatacggctcscmaccsyccccggkggsggscacggccgtagtccc
atgttggctaggtaccgcaccggattgacatgcccgtcctgcgtgcggacctcgaaatgc
agataa

DBGET integrated database retrieval system