KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26620Help
Entry
I917_26620        CDS       T02654                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K16652  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase [EC:1.1.1.333]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I917_26620
Enzymes [BR:mtuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.333  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase
     I917_26620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AGL25331
UniProt: R4MBM8
LinkDB All DBs
Position
4230023..4230787
Genome map
AA seq 254 aa AA seqDB search
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAAXIVLACLPDDPRREDAAAAMKQAGA
RSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAXGXLGDAEELWQNQRKAVQIAEINY
TAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALRE
YGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMV
LRHIPRSIFRKLPX
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggttcttgatgccgtaggaaacccccagacggtgctgctgctcggtggcacctccgag
atcgggctcgccatctgcgagcgctacctgcacaattcggcggcccrcatcgtgctggcc
tgcctgcccgacgacccacggcgggaggacgcggccgctgcgatgaagcaggccggcgcg
cggtcggtggagctgatcgactttgacgccctggataccgacagccacccgaagatgatc
gaggcggccttctccggcggtgatgtggacgtggctatygtcgcgwtcggcttkctcggc
gacgccgaagagctgtggcagaaccagcgcaaggcggtgcagatcgccgaaatcaactac
accgcagcggtttcggtgggcgtgctgctggctgagaagatgcgcgctcagggcttcggt
cagatcatcgcgatgagctcggccgccggtgagcgggtgcgacgggcgaacttcgtctac
ggctccaccaaggccggtctggacgggttttacctggggttgtcagaagcgctgcgcgag
tacggtgttcgtgtgctggtgatccggcccggccaggtgcgtacccggatgagcgcgcac
ctcaaggaagctccattgaccgtcgacaaggagtacgtcgccaacctcgcggtgaccgcg
tccgcaaaaggtaaggaattggtttgggcgccagcagcgttccgctacgtcatgatggtg
ttgcgtcacatcccgcggagcatcttccgcaagctgcccayctga

DBGET integrated database retrieval system