KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26660Help
Entry
I917_26660        CDS       T02654                                 

Definition
(GenBank) arabinosyl transferase B
  KO
K11385  arabinosyltransferase A [EC:2.4.2.-]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00572  Arabinogalactan biosynthesis - Mycobacterium
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00572 Arabinogalactan biosynthesis - Mycobacterium
    I917_26660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtuh01003]
    I917_26660
Enzymes [BR:mtuh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     I917_26660
Glycosyltransferases [BR:mtuh01003]
 Polysaccharide
  Bacterial polysaccharide
   I917_26660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arabinose_trans Arabino_trans_C Arabino_trans_N
Motif
Other DBs
NCBI-ProteinID: AGL25332
UniProt: R4MCX0
LinkDB All DBs
Position
4236110..4241668
Genome map
AA seq 1852 aa AA seqDB search
MPHDGNERSHRIARLAAVXSGIAGLLLCGIVPLLPVNQTTATIFWPQGSTADGNITQITA
PLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVDTGKAGLFVRANQDTVVVAFRD
SVAAVAARSTIAAGGCSALHIWADTGGAGADFMGIPGGAGTLPPEKKPQVGGIFTDLKVG
AQPGLSARVDIDTRFITTPGALKKAVMLLGVLAVLVAMVGLAALDRLSRGRTLRDWLTRY
RPRVRVGFASRLADAAVIATLLLWHVIGATSSDDGYLLTVARVAPKAGYVANYYRYFGTT
EAPFDWYTSVLAQLAAVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLASNRVA
VFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSIALGRLAPAAVAIIVATLTAT
LAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAPLAVLAAALSLITVVVFRDQTLATVA
EXARIKYKVGPTIAWYQDFLRYYFLTVEXNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGR
VAGLASGPAWRLIGTTAXGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSR
RNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSILTGLL
AAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAGEVGSMAKAAVFRYPLYTTAK
ANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPGQAFGPDGPLGGISPVGFKPEGVGED
LKSDPVVSKPGLVNSDASPNKPNAAITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVM
GSYGENNLAATATSAWYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTG
PDGRIQPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFAFTPPR
VPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIAELPQYRILPDHKQTAASSNL
WQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWGSVEQYHRLVPADQAPDAVVEEGVIT
VPGWGRPGPBSXXLXWTXXASRRKSTPXRAILGAFASARGTRWVATIAGLIGFVLSVATP
LLPVVQTTAMLDWPQRGQLGSVTAPLISLTPVDFTATVPCDVVRAMPPAGGVVLXTAPKQ
GKDANLQALFVVVSAQRVDVTDRNVVILSVPREQVTSPQCQRIEVTSTHAGTFANFVGLK
DPSGAPLRSGFPDPNLRPQIVGVFTDLTGPAPPGLAVSATIDTRFSTRPTTLKLLAIIGA
IVATVVALIALWRLDQLDGRGSIAQLLLRPFRPASSPGGMRRLIPASWRTFTLTDAVVIF
GFLLWHVIGANSSDDGYILGMARVADHAGYMSNYFRWFGSPEDPFGWYYNLLALMTHXSD
ASLWMRLPDLAAGLVCWLLLSREVLPRLGPAVEASKPAYWAAAMVLLTAWMPFNNGLRPE
GIIALGSLVTYVLIERSMRYSRLTPAALAVVTAAFTLGVQPTGLIAVAALVAGGRPMLRI
LVRRHRLVGTLPLVSPMLAAGTVILTVVFADQTLSTVLEATRVRAKIGPSQAWYTENLRY
YYLILPTVDGSLSRRFGFLITALCLFTAVFIMLRRKRIPSVARGPAWRLMGVIFGTMFFL
MFTPTKWVHHFGLFAAVGAAMAALTTXLVSPSVLRWSRNRMAFLAALFFLLALCWATTNG
WWYVSSYGVPFNSAMPKIDGITVSTIFFALFAIAAGYAAWLHFAPRGAGEGRLIRALTTA
PVPIVAGFMAXGVRRVHGGRDRATVPDLLQRLXQRXGVCRRLRXGRRRTRRA
NT seq 5559 nt NT seq  +upstreamnt  +downstreamnt
gtgccccacgacggtaatgagcgatctcaccggatcgcacgcctagcagccgtcktctcg
ggaatcgcgggtctgctgctgtgcggcatcgttccgctgcttccggtgaaccaaaccacc
gcgaccatcttctggccgcagggcagcaccgccgacggcaacatcacccagatcaccgcc
cctctggtatccggggcgccacgcgcgctggacatctcgatcccctgctcggccatcgcc
acgctgcccgccaacggcggcctggtgctgtccacactgccggccggtggcgtggatacc
ggtaaggccgggctgttcgtccgcgccaaccaggacacggtcgtcgtggcgttccgcgac
tcggtggccgcggtggcggcccgctccacgatcgcagcgggaggctgtagcgcgctgcat
atctgggccgataccggcggcgcgggcgctgattttatgggtatacccggcggcgccggg
accctgccgccggagaagaagccacaggttggcggcatcttcaccgacctgaaggtcgga
gcgcagcccgggctgtcggcccgcgtcgacatcgacactcggtttatcacgacgcccggc
gcgctcaagaaggccgtgatgctcctcggcgtgctggcggtcctggtagccatggtgggg
ctggccgcgctggaccggctcagcaggggccgcaccctgcgcgactggctgacccgatat
cgcccgcgggtgcgggtcggattcgccagccggctcgctgacgcagcggtgatcgcgacc
ttgttgctctggcatgtcatcggcgccacctcgtccgatgacggctaccttctgaccgtc
gcccgggtcgccccgaaggccggctatgtagccaactactaccggtatttcggcacgacg
gaggcgccgttcgactggtatacatcggtgcttgcccagctggcggcggtgagcaccgcc
ggcgtctggatgcgcctgcccgccaccctggccggaatcgcctgctggctgatcgtcagc
cgtttcgtgctgcggcggctgggaccgggcccgggcgggctggcgtccaaccgggtcgct
gtgttcaccgctggtgcggtgttcctgtccgcctggctgccgttcaacaacggcctgcgt
cccgagccgctgatcgcgctgggtgtgctggtcacgtgggtgttggtggaacggtcgatc
gcgctcggacggctggccccggccgcggtagccatcatcgtggcgacgcttaccgcgacg
ctggcaccgcaggggttgatcgcgctggccccgctgctgactggtgcgcgcgccatcgcc
cagaggatccggcgccgccgggcgaccgatggactgctggcgccgctggcggtgctggcc
gcggcgttgtcgctgatcaccgtggtggtgtttcgggaccagacgctggccacggtggcc
gaatsggcacgcatcaagtacaaggtcggcccgaccatcgcctggtaccaggacttcctg
cgctactacttccttaccgtggagrgcaacgttgaggggtcgatgtcccgccggttcgcg
gtgctggtgttgctgttctgcctgttcggggtgctgttcgtgctgctgcggcgcggccgg
gtggcggggctggccagcggcccggcctggcgactgatcggcactacggcgstcggcytg
ctgctgctcacgttcacgccaaccaagtgggccgtgcagttcggcgcattcgccgggctg
gccggggtgttgggtgcggtcaccgcgttcacctttgcccgcatcggtctacatagtcga
cgcaacctcacgctgtacgtgaccgcgttgctgttcgtgctggcgtgggcaacctcgggc
atcaacgggtggttctacgtcggcaactacggggtgccgtggtatgacatccagcccgtc
atcgccagccacccggtgacgtcgatgtttctgacgctgtcgatcctcaccggattgctg
gcagcctggtatcacttccggatggactacgccgggcacaccgaagtcaaagacaaccgg
cgcaaccgcatcttggcctctacgccactgctggtggtcgcggtgatcatggtcgcaggc
gaagtcggctcgatggccaaggccgcggtgttccgttacccgctttacaccaccgccaag
gccaacctgaccgcgctcagcaccgggctgtccagctgtgcgatggccgacgacgtgctg
gccgagcccgaccccaatgccggcatgctgcaaccggttccgggccaggcgttcggaccg
gacggaccgctgggcggtatcagtcccgtcggcttcaaacccgagggcgtgggcgaggac
ctcaagtccgacccggtggtctccaaacccgggctggtcaactccgatgcgtcgcccaac
aaacccaacgccgccatcaccgactccgcgggcaccgccggagggaagggcccggtcggg
atcaacgggtcgcacgcggcgctgccgttcggattggacccggcacgtaccccggtgatg
ggcagctacggggagaacaacctggccgccacggccacctcggcctggtaccagttaccg
ccccgcagcccggaccggccgctggtggtggtttccgcggccggcgccatctggtcctac
aaggaggacggcgatttcatctacggccagtccctgaaactgcagtggggcgtcaccggc
ccggacggccgcatccagccactggggcaggtatttccgatcgacatcggaccgcaaccc
gcgtggcgcaatctgcggtttccgctggcctgggcgccgccggaggccgacgtggcgcgc
attgtcgcctatgacccgaacctgagccctgagcaatggttcgccttcaccccgccccgg
gttccggtgctggaatctctgcagcggttgatcgggtcagcgacaccggtgttgatggac
atcgcgaccgcagccaacttcccctgccagcgaccgttttccgagcatctcggcattgcc
gagcttccgcagtaccggatcctgccggaccacaagcagacggcggcgtcgtcgaaccta
tggcagtccagctcgaccggcggkccgttcctgttcacccaggcgctgctgcgcacctcg
acgatcgccacgtacctgcgtggggactggtatcgcgactggggatcggtggagcagtac
caccggctggtgccggccgatcaggctccagacgccgttgtcgaggagggcgtgatcact
gtgcccggctggggtcggccaggaccgrattcwkggcractkcyatggacacwgkgcgcg
agcagacgcaaaagcaccccawwtcgggcgattttgggggcttttgcgtctgctcgcggg
acgcgctgggtggccaccatcgccgggctgattggctttgtgttgtcggtggcgacgccg
ctgctgcccgtcgtgcagaccaccgcgatgctcgactggccacagcgggggcaactgggc
agcgtgaccgccccgctgatctcgctgacgccggtcgactttaccgccaccgtgccgtgc
gacgtggtgcgcgccatgccacccgcgggcggsgtggtgctggscaccgcacccaagcaa
ggcaaggacgccaatttgcaggcgttgttcgtcgtcgtcagcgcccagcgcgtggacgtc
accgaccgcaacgtggtgatcttgtccgtgccgcgcgagcaggtgacgtccccgcagtgt
caacgcatcgaggtcacctctacccacgccggcaccttcgccaacttcgtcgggctcaag
gacccgtcgggcgcgccgctgcgcagcggcttccccgaccccaacctgcgcccgcagatt
gtcggggtgttcaccgacctgaccgggcccgcgccgcccgggctggcggtctcggcgacc
atcgacacccggttctccacccggccgaccacgctgaaactgctggcgatcatcggggcg
atcgtggccaccgtcgtcgcactgatcgcgttgtggcgcctggaccagttggacgggcgg
ggctcaattgcccagctcctcctcaggccgttccggcctgcatcgtcgccgggcggcatg
cgccggctgattccggcaagctggcgcaccttcaccctgaccgacgccgtggtgatattc
ggcttcctgctctggcatgtcatcggcgcgaattcgtcggacgacggctacatcctgggc
atggcccgagtcgccgaccacgccggctacatgtccaactatttccgctggttcggcagc
ccggaggatcccttcggctggtattacaacctgctggcgctgatgacccatktcagcgac
gccagtctgtggatgcgcctgccagacctggccgccgggctagtgtgctggctgctgctg
tcgcgtgaggtgctgccccgcctcgggccggcggtggaggccagcaaacccgcctactgg
gcggcggccatggtcttgctgaccgcgtggatgccgttcaacaacggcctgcggccggag
ggcatcatcgcgctcggctcgctggtcacctatgtgctgatcgagcggtccatgcggtac
agccggctcacaccggcggcgctggccgtcgttaccgccgcattcacactgggtgtgcag
cccaccggcctgatcgcggtggccgcgctggtggccggcggccgcccgatgctgcggatc
ttggtgcgccgtcatcgcctggtcggcacgttgccgttggtgtcgccgatgctggccgcc
ggcaccgtcatcctgaccgtggtgttcgccgaccagaccctgtcaacggtgttggaagcc
accagggttcgcgccaaaatcgggccgagccaggcgtggtataccgagaacctgcgttac
tactacctcatcctgcccaccgtcgacggttcgctgtcgcggcgcttcggctttttgatc
accgcgctatgcctgttcaccgcggtgttcatcatgttgcggcgcaagcgaattcccagc
gtggcccgcggaccggcgtggcggctgatgggcgtcatcttcggcaccatgttcttcctg
atgttcacgcccaccaagtgggtgcaccacttcgggctgttcgccgccgtaggggcggcg
atggccgcgctgacgacggkgttggtatccccatcggtgctgcgctggtcgcgcaaccgg
atggcgttcctggcggcgttattcttcctgctggcgttgtgttgggccaccaccaacggc
tggtggtatgtctccagctacggtgtgccgttcaacagcgcgatgccgaagatcgacggg
atcacagtcagcacaatctttttcgccctgtttgcgatcgccgccggctatgcggcctgg
ctgcacttcgcgccccgcggcgccggcgaagggcggctgatccgcgcgctgacgacagcc
ccggtaccgatcgtggccggtttcatggcggsgggggttcgtcgcgtccatggtggccgg
gatcgtgcgacagtacccgacctactccaacggctggkscaacgtgmgggcgtttgtcgg
cggctgcggrctggccgacgacgtactcgtcgagcctga

DBGET integrated database retrieval system