KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26780Help
Entry
I917_26780        CDS       T02654                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh00052  Galactose metabolism
mtuh00520  Amino sugar and nucleotide sugar metabolism
mtuh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    I917_26780
   00520 Amino sugar and nucleotide sugar metabolism
    I917_26780
Enzymes [BR:mtuh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     I917_26780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase Thi4 DAO NAD_binding_9 Pyr_redox FAD_oxidored Pyr_redox_2 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AGL25348
UniProt: R4M888
LinkDB All DBs
Structure
PDB: 

Position
complement(4265209..4266408)
Genome map
AA seq 399 aa AA seqDB search
MQPMTARFDLFVVGSGFFGLTIAERVATQLDKRVLVLERRPHIGGNAYXEAEPQTGIEVH
KYGAHLFHTSNKRVWDYVRQFTDFTDYRHRVFAMHNGQAYQFPMGLGLVSQFFGKYFTPX
QXRQLIAEQAAEIDTADAQNLEEKAISLIGRPLYEAFVKGYTAKQWQTDPKELPAANITR
LPVRYTFDNRYFSDTYEGLPTDGYTAWLQNMAADHRIEVRLNTDWFBVRGZLRPGSPAAP
VVYTGPLDRYFDYAEGRLGWRTLDFEVEVLPIGDFQGTAVMNYNDLDVPYTRIHEFRHFH
PERDYPTDKTVIMREYSRFAEDDXEPYYPINTEADRALLATYRARAKSETASSKVLFGGR
LGTYQYLDMHMAIASALNMYDNVLAPHLRDGVPLLQDGA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgatgaccgctcgttttgaccttttcgtcgtcggctcaggattcttcggcctg
acgattgccgagcgcgtggccacccaactcgacaagcgcgtgctcgtcctcgagcggcgc
ccgcacatcgggggcaatgcctatyccgaagccgagccacagaccggcatcgaggtccac
aagtacggtgcgcacctgtttcacacctctaataagagagtgtgggactacgtgcggcag
ttcaccgacttcaccgactaccggcaccgggtcttcgcgatgcacaacgggcaggcatat
cagtttccgatggggctcggcctggtatcgcagttcttcggcaagtacttcacgcccgrg
caascccgccagctgatcgccgagcaggccgccgagatcgacaccgccgacgcgcagaac
ctcgaggagaaggccatctcgctgatcggccggccgctctacgaagcgttcgtcaagggg
tacacggccaagcaatggcagactgaccccaaagaacttccggccgccaacatcacgcgg
cttcccgtgcgctacaccttcgacaaccggtatttcagcgatacttacgagggtttgccg
accgacgggtacacggcgtggttgcaaaacatggccgctgaccaccgcatcgaggtcagg
ctgaacaccgactggttcracgtgcgcggcsagctgcgccccggcagcccggcggccccg
gtcgtttacaccggcccgctsgaccgctacttcgactacgccgaaggccgattgggctgg
cgcaccttggacttcgaggtggargtgctaccgatcggggactttcagggcaccgcggtg
atgaactacaacgatctcgacgtcccctacacgcgcatccacgagttccgccacttccac
cccgagcgtgactacccaacggacaaaacggtgatcatgcgggaatactcccggttcgcc
gaggacgacgrsgagccatactatccgatcaacaccgaggctgaccgcgccctgttggcc
acctatcgggccagggcgaagtccgagaccgcgtcatcgaaggtactgttcggcggccgg
ttgggcacctaccaatatctggatatgcatatggccattgccagcgccttgaacatgtac
gacaacgtcctcgcgccgcatctgcgcgacggcgtcccactgcttcaggacggcgcatga

DBGET integrated database retrieval system