KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_26820Help
Entry
I917_26820        CDS       T02654                                 

Definition
(GenBank) hypothetical protein
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP HAD Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AGL25353
UniProt: R4M894
LinkDB All DBs
Position
complement(4271341..4272162)
Genome map
AA seq 273 aa AA seqDB search
MKPTVPALVACDVDGTLLDDGETVTKRTRDAVHAAVDAGTHFILATGRPPRWVRPIVDAL
GFAPMAVCANGAVIYDPGTDRVMSVRTLPVDALATLAEVATRVIPGAGLAVERIGERAHD
TATPQFVSSPGYEHAWLNPDNTEVSIDHLLSAPAIKLLIRKAGAASADMAAELAKHVGFE
GDITYSTNNGLVEIVPLGISKATGVDEIARPLGISDAEVVAFGDMPNDVPMLLRAGLGVA
MXNAHPDALAVADEVTAPNSEDGVARVLERWWS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccgactgtgccggcgctcgtcgcgtgtgacgtcgacggaaccctgctcgatgac
ggagaaaccgtcaccaaacgcactcgcgacgcggtgcatgccgcggtagacgccggcacg
cacttcatcctggccaccggccggccgccgcgctgggtgcgacccatcgtcgatgccctc
ggcttcgcgccgatggcggtgtgcgccaacggcgccgtcatctacgaccccgggaccgat
cgggtgatgtcggtgcgcaccctgcccgtcgacgccctggcaacgttggccgaagttgcg
acccgcgtcataccgggtgcgggactggcggtcgagcggatcggcgagcgcgcacacgac
acggcgaccccccagttcgtcagctcgccgggctacgagcatgcgtggctgaatccggac
aacaccgaagtgtcgatcgaccacctgctcagcgcgccggcgatcaaactgctgatccgt
aaagccggtgctgccagtgccgacatggccgccgaactggctaagcatgtcggtttcgag
ggcgatatcacctactcgaccaataacgggctggtggagatcgtgccgctcggtatcagc
aaggccaccggtgtcgacgagattgcccggccgcttggaatttccgacgcggaggtggtg
gcgttcggcgacatgcccaacgacgtgccgatgctgctgcgggccggtttgggtgtggcg
atgsktaacgcgcatcccgacgcgctggccgtcgccgacgaggtcactgcacccaatagc
gaggacggcgtcgcgcgggtgctggagcgctggtggtcctag

DBGET integrated database retrieval system