KEGG   Mycobacterium tuberculosis Haarlem: TBHG_02046Help
Entry
TBHG_02046        CDS       T02845                                 

Definition
(GenBank) transmembrane serine/threonine-protein kinase J PknJ
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtul01001]
    TBHG_02046
Enzymes [BR:mtul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TBHG_02046
Protein kinases [BR:mtul01001]
 Serine/threonine kinases: Other
  Bacterial family
   TBHG_02046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PknH_C Pkinase_Tyr APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: EBA42460
LinkDB All DBs
Position
2349038..2350807
Genome map
AA seq 589 aa AA seqDB search
MAHELSAGSVFAGYRIERMLGAGGMGTVYLARNPDLPRSEALKVLAAELSRDLDFRARFV
READVAAGLDHPNIVAVHQRGQFEGRLWIAMQFVDGGNAEDALRAATMTTARAVYVIGEV
AKALDYAHQQGVIHRDIKPANFLLSRAAGGDERVLLSDFGIARALGDTGLTSTGSVLATL
AYAAPEVLAGQGFDGRADLYSLGCALFRLLTGEAPFAAGAGAAVAVVAGHLHQPPPTVSD
RVPGLSAAMDAVIATAMAKDPMRRFTSAGEFAHAAAAALYGGATDGWVPPSPAPHVISQG
AVPGSPWWQHPVGSVTALATPPGHGWPPGLPPLPRRPRRYRRGVAAVAAVMVVAAAAVTA
VTMTSHQPRTATPPSAAALSPTSSSTTPPQPPIVTRSRLPGLLPPLDDVKNFVGIQNLVA
HEPMLQPQTPNGSINPAECWPAVGGGVPSAYDLGTVIGFYGLTIDEPPTGTAPNQVGQLI
VAFRDAATAQRHLADLASIWRRCGGRTVTLFRSEWRRPVELSTSVPEVVDGITTMVLTAQ
GPVLRVREDHAIAAKNNVLVDVDIMTPDTSRGQQAVIGITNYILAKIPG
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtggcccacgagttgagtgcgggttcggtttttgccgggtaccggatagagcggatgcta
ggtgccggcggaatgggcaccgtatatctggcgcgtaatcccgatctgccgcgtagcgaa
gccttgaaagtccttgctgcggagttgtcgcgtgacctcgattttcgggcacggtttgtc
cgcgaagccgatgtggccgcggggttggatcatcccaacatcgtggcggttcatcagcgc
ggccagttcgagggtcggctatggattgcgatgcagttcgtcgatggcgggaacgctgag
gatgcgctgcgggcggcgaccatgaccacagcgcgggcggtgtacgtgatcggcgaggtc
gccaaggcgctcgactatgcgcaccaacaaggcgtgatacatcgcgatatcaagccggcg
aacttcttgttgtcgcgagccgctggcggcgatgaacgagtgctgctaagcgattttggg
atcgcgcgtgcgctcggcgacacgggactgacgtccaccggttcggtgctggccacgttg
gcctatgctgcgccggaagttcttgcagggcaaggttttgatggccgggccgatttgtat
tcgttggggtgtgccctatttcggctactaaccggtgaggcgccgtttgccgccggtgct
ggagcggcggtggcagtggtggcgggtcatctgcaccaaccgccgccgacggtcagcgat
cgcgtgccagggctgtcggcggcgatggatgcggtgatcgccactgcgatggccaaggat
cccatgcgtcggttcacctcagcgggtgaattcgcacatgccgccgccgcagccctgtac
gggggagccaccgacggatgggtgccgccgagccccgcgccgcacgtcatatcgcaaggc
gccgtgccaggttcgccgtggtggcagcatccggtcgggtcagtgaccgcgttggccacg
ccgcccggtcacggttggccgccaggcctgccgccgctgccgagacgaccgcgccgctac
cgtcggggcgtggcggcggtggcggccgtgatggtggtggccgccgcggccgtcaccgcg
gtgaccatgacatcgcaccaaccgcggaccgcgacgccgccaagcgctgcagccctttct
cccacctcgtccagcacaacaccaccgcaaccaccgatcgtgacaaggtcgcgcctaccc
gggttgttgccgccccttgatgacgtcaaaaacttcgtgggcatccagaacctggtcgcc
catgagccaatgcttcaaccccagactcccaacgggtcaatcaaccccgcggagtgctgg
ccggcggttgggggtggcgttcctagcgcctacgacctggggaccgtcatcggcttttac
gggttgacaatcgacgagccgcccaccgggactgccccaaatcaagtggggcaactgatc
gtggcctttcgcgacgcggccacagcccaaaggcatttggccgatttggcgtcgatctgg
cgccgatgcgggggtcgaaccgtaacactcttccgtagtgagtggcgaaggcccgttgaa
ctgtcgacgagcgttcccgaagtcgttgatggcatcaccaccatggtgttgacggcgcag
ggaccggtgctacgagtccgcgaagaccatgcgatcgccgcgaagaataatgtgcttgtc
gatgtcgacatcatgacgcccgacaccagccgcggccagcaggcggtcatcggcatcacc
aactacatcctcgccaagatacccggctga

DBGET integrated database retrieval system