KEGG   Mycobacterium tuberculosis Haarlem: TBHG_02258Help
Entry
TBHG_02258        CDS       T02845                                 

Definition
(GenBank) cationic amino acid transport integral membrane protein RocE
Organism
mtul  Mycobacterium tuberculosis Haarlem
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease ThiS RP-C_C
Motif
Other DBs
NCBI-ProteinID: EBA42659
LinkDB All DBs
Position
complement(2586510..2587940)
Genome map
AA seq 476 aa AA seqDB search
MPTTSMSLRELMLRRRPVSGAPVASGASGNLKRSFGTFQLTMFGVGATIGTGIFFVLAQA
VPEAGPGVIVSFIIAGIAAGLAAICYAELASAVPISGSAYSYAYTTLGEAVAMVVAACLL
LEYGVATAAVAVGWSGYVNKLLSNLFGFQMPHVLSAAPWDTHPGWVNLPAVILIGLCALL
LIRGASESARVNAIMVLIKLGVLGMFMIIAFSAYSADHLKDFVPFGVAGIGSAAGTIFFS
YIGLDAVSTAGDEVKDPQKTMPRALIAALVVVTGVYVLVALAALGTQPWQDFAEQETAGL
AIILDNVTHGEWASTILAAGAVVSIFTVTLVTMYGQTRILFAMGRDGLLPARFAKVNPRT
MTPVHNTVIVAIFASTLAAFIPLDSLADMVSIGTLTAFSVVAVGVIVLRVREPDLPRGFK
VPGYPVTPVLSVLACGYILASLHWYTWLAFSGWVAVAVIFYLMWGRHHSALNEEVP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
ttgccgacaacgtcgatgagccttcgagaactgatgctgcggcgccgcccggtgagcggc
gccccggtcgcatccggggcatcggggaacctcaagcggagtttcggcaccttccagctg
accatgttcggggttggcgcgacgataggtaccggcatctttttcgtgcttgcccaggca
gttccagaggccggcccgggcgtgattgtttcgttcatcatcgccggcatcgccgctggg
ctcgcggctatctgctacgcggaactggcttccgccgtgccgatttccgggtcggcgtac
tcctacgcgtacacgacgctgggcgaggcggtcgcgatggtggtggcggcctgcctactg
ctggaatacggggtagccaccgcagcggtcgcggtcggctggagtggctacgtgaacaag
ctgctgagtaatctgttcggatttcagatgccgcacgtattgtcggcggcgccgtgggac
acccatcccggttgggtgaacctgcccgccgtcatcctgatcgggctatgcgcgctgctg
ttgattcgaggggccagcgagtcggcgagggtcaacgcgatcatggtgctgatcaagctc
ggcgtgctgggcatgttcatgatcatcgcgttcagcgcgtacagcgccgaccacctcaag
gatttcgtcccattcggcgtcgccggcatcggctccgcggcgggcacgatcttcttctca
tacatcggccttgacgcggtgtcgaccgccggcgacgaggtgaaggacccgcagaagacc
atgccgcgtgcgctgatcgcagcgctggtggtcgtcaccggtgtctacgtgctggtcgca
ctggccgcgctgggcacccaaccgtggcaggacttcgcagagcaggaaaccgccgggctg
gccatcatcttggacaacgtcacgcatggcgaatgggccagcacgattctggccgccggt
gcggtggtctcgattttcaccgtcacgctggtcaccatgtacggccagacccggatcctg
ttcgcgatggggcgcgacgggctgctgccggcgcggttcgcgaaggtgaatccgcgcacc
atgacgccggtgcacaacacggtgatcgtcgcgatcttcgcatcgacgctggccgccttc
ataccgctggatagcttggcggacatggtgtccatcggcacgctcaccgcgttcagcgtg
gtggctgtgggtgtgatcgttctacgggtgcgcgagcccgacttaccccgagggttcaag
gtacccggttaccctgtgacgcctgttctttcggtgctggcctgcgggtatatcctggcc
agcttgcactggtacacctggctggcgttcagcggatgggtggcggtggcagtgatcttt
tacctgatgtggggtcggcaccacagtgcgctcaacgaggaagtgccgtga

DBGET integrated database retrieval system