KEGG   Mycobacterium tuberculosis Haarlem: TBHG_02911Help
Entry
TBHG_02911        CDS       T02845                                 

Definition
(GenBank) d-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00473  D-Alanine metabolism
mtul00550  Peptidoglycan biosynthesis
mtul01100  Metabolic pathways
mtul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TBHG_02911
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TBHG_02911
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    TBHG_02911
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtul01011]
    TBHG_02911
Enzymes [BR:mtul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TBHG_02911
Peptidoglycan biosynthesis and degradation proteins [BR:mtul01011]
 Precursor biosynthesis
  Amino acid ligase
   TBHG_02911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGV30864
LinkDB All DBs
Structure
PDB: 

Position
complement(3332894..3334015)
Genome map
AA seq 373 aa AA seqDB search
MSANDRRDRRVRVAVVFGGRSNEHAISCVSAGSILRNLDSRRFDVIAVGITPAGSWVLTD
ANPDALTITNRELPQVKSGSGTELALPADPRRGGQLVSLPPGAGEVLESVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLH
RQECERLGLPVFVKPARGGSSIGVSRVSSWDQLPAAVARARRHDPKVIVEAAISGRELEC
GVLEMPDGTLEASTLGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQ
LAIRAFAAIDCRGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MIETALARGVGLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctaacgaccggcgtgatcggcgtgtccgcgttgccgtcgtgttcggcgggcgc
agcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctgcgcaacctggactcg
cggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcgtgggtgctcaccgac
gccaaccccgacgccctgacgatcaccaaccgggagcttcctcaggtcaaatcaggatcg
ggcaccgagctggcgctgccggccgatccgcggcgtggtggccagttggtgtcgctgccg
cccggggccggcgaggttctggagtcggtcgacgtggtgttcccggtactgcacggcccg
tacggcgaggacggcacgatccagggactgctcgaactcgccggggtgccctacgtgggc
gccggtgtgctggccagtgccgtcggcatggacaaggagttcaccaagaagctgctcgcc
gccgatggacttccggtgggtgcgtacgcggtgctgcgtccgccgcggtcgacactgcac
cgccaggagtgcgaacggctgggcttaccggtgttcgtcaaacccgcccgaggcggctcg
tcgatcggtgttagccgggtgtcgagttgggatcaactgcccgccgcggtcgcgcgggcc
cgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggccgcgagctggaatgc
ggtgtgctcgaaatgccggacggcacactggaagccagcacgctgggggagatccgggtg
gccggggtgcggggacgcgaggactctttctacgacttcgcaaccaagtatctcgacgac
gcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgcagaggcgattcgtcag
ctggcgatccgggcgttcgcggctatcgactgccggggtctggccagggtggacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacacgatgccgggattcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggtgtcgactatccgaccctgctggcgacg
atgatcgagacggcattggcccgcggcgtgggcctgcactag

DBGET integrated database retrieval system