KEGG   Mycobacterium tuberculosis Haarlem: TBHG_03258Help
Entry
TBHG_03258        CDS       T02845                                 

Definition
(GenBank) methyltransferase
Organism
mtul  Mycobacterium tuberculosis Haarlem
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_15 TPMT
Motif
Other DBs
NCBI-ProteinID: EBA43501
LinkDB All DBs
Position
complement(3701271..3701885)
Genome map
AA seq 204 aa AA seqDB search
MSVQTDPALREHPNRVDWNARYERAGSAHAPFAPVPWLADVLRAGVPDGPVLELASGRSG
TALALAAHGRQVTAIDVSDVALLQLDSEAVRRGVADRLNLVQADLGCWEPGETRFALVLS
RLFWDAAIFHRACEAVMPGGVLAWESLALSGAEAGTASAKRRVKPGEPACLLPADFTVVH
EGQGNCDSAPSRIMIARRSPLPGA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcagacggatccggcgctgcgggagcaccccaaccgcgtcgactggaacgcg
cgatacgaacgcgcgggttcggcgcacgcgccgtttgccccggtgccttggctcgccgat
gtcctcagagcaggcgttccggacggtcccgttctggagttagccagcggtcgatcgggt
accgcactggcgttggccgcccacggccgccaggtcaccgcaatcgatgtgtccgatgtc
gcgctgctgcagctggacagcgaggccgtgcgtcgaggcgtggccgatcggctcaacctc
gtgcaggccgacttgggctgctgggaacccggcgagacgcgtttcgcgctggtgctcagc
aggctcttttgggatgcggcgatatttcaccgcgcctgtgaggcggtgatgccaggcggc
gtattggcatgggagtcgctggctctcagtggcgccgaggcgggcacagccagcgcgaag
cgacgtgtcaagccgggagagccagcgtgtctgcttcctgccgacttcaccgttgtacac
gaggggcagggtaactgcgattcggcgccgtcgcggatcatgatcgcgcggcgctcaccg
ttgccaggggcatag

DBGET integrated database retrieval system