KEGG   Mycobacterium tuberculosis Haarlem: TBHG_04161
Entry
TBHG_04161        CDS       T02845                                 

Definition
(GenBank) arylamine N-acetyltransferase nat
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mtul  Mycobacterium tuberculosis Haarlem
Pathway
mtul00983  Drug metabolism - other enzymes
mtul01100  Metabolic pathways
mtul01110  Biosynthesis of secondary metabolites
mtul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtul00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    TBHG_04161
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TBHG_04161
   00983 Drug metabolism - other enzymes
    TBHG_04161
Enzymes [BR:mtul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     TBHG_04161
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-ProteinID: AGV30936
LinkDB
Structure
PDB: 
4BGF

Position
complement(4004156..4005544)
AA seq 462 aa
MARADAKSPILRACWAILRLLAVAGKQSGEPRPVCRVVGAAVLADGEYADAYVKEQHCRR
SVRRGLPCRPSRHRPASLRCRGSAIASVTGIMMRCCVRRRSSDPPGIRPDGASSHRMGEC
QRAVCRSRRHVSLRGHFVCRRPRNSCGKPQSVRHSWPAARRTPEYPAVGPTRRRGQNGNM
ALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKL
VLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSG
GCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTT
QTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLAD
AAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
NT seq 1389 nt   +upstreamnt  +downstreamnt
gtggcgcgagcagacgcaaaatcgcccattttgcgggcgtgttgggcgattttgcgtctg
ctcgccgtcgccggtaagcagtctggtgagccacgtccggtatgtcgcgtggttggggca
gctgtcctcgcggatggcgaatatgcagacgcttacgtcaaggagcagcattgtcgccga
tcagttcggcgagggcttccttgtcgtccaagtcgacaccggcctgcaagcctccggtgc
cgtgggtcggcaatagcatcagtaacaggcatcatgatgcgttgttgtgtccggcgccga
tcctccgacccgccgggcattcggccagatggcgcgagcagccaccggatgggtgagtgt
cagcgggcagtttgccgtagccgccgacacgtgtcgctgcgagggcactttgtttgccgt
cgacccagaaactcatgtggcaaaccacaatcggtgcgacatagttggccggctgcgcga
cgaacgcccgaataccctgcggtcggtccgacgcggcgacgaggtcagaatggcaacatg
gcactggatctgaccgcgtacttcgatcgcatcaactatcgcggcgctaccgatccaacc
ctggatgttctgcaggatctggtgaccgtgcacagtcgaacgattccgttcgagaacctc
gacccgctgctgggggtgccggtcgacgacctcagtccacaggcgctggccgacaagctg
gtacttcggcgccgaggcgggtactgctttgagcacaacgggctgatgggttatgtgctg
gccgaactcggctatcgggtgcgccgattcgccgcccgcgtcgtctggaagctcgcgccg
gacgcgcccctgccgccgcagacgcacaccctgctgggggtcacgttccccggctcgggc
ggatgctatctcgtcgacgtcggattcggcggccaaacaccgacctcaccgcttcgcctc
gaaaccggcgccgtccagccgacaacgcacgaaccttatcggctcgaggaccgcgtcgac
ggctttgtcttgcaggcgatggtccgggacacatggcagacactgtacgaattcaccacc
cagacccgcccgcagatcgatctgaaagtggccagctggtacgcctcaacacacccggca
tcgaagttcgtcacgggactgaccgccgcggtgatcaccgacgacgcccggtggaaccta
tctggccgcgaccttgccgttcaccgtgccggtggtaccgagaagatccgccttgccgat
gcggcagcggttgtcgacaccctgagcgaacggttcgggatcaacgtggcagatatcggc
gagcgcggcgcgctcgagacgcgcatcgacgagctattggctcggcagccaggagccgat
gcgccgtaa

DBGET integrated database retrieval system