KEGG   Methylocella tundrae: MTUNDRAET4_1691Help
Entry
MTUNDRAET4_1691   CDS       T05970                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtun  Methylocella tundrae
Pathway
mtun00564  Glycerophospholipid metabolism
mtun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MTUNDRAET4_1691
Enzymes [BR:mtun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MTUNDRAET4_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA Pyr_redox NAD_binding_8 HI0933_like Pyr_redox_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: VFU08584
UniProt: A0A4U8YXA8
LinkDB All DBs
Position
1:complement(1512300..1513916)
Genome map
AA seq 538 aa AA seqDB search
MDRSSALAALRSGGTFDVLVVGGGATGCGVALDAASRGLRTALVERGDFAEGASGRSTKL
VHGGVRYLELAIRRLDRTQYNLVRDGLRERAIFLKNAPHLAHRLALVSPLYRWRDAPYIF
AGLRIYDRLAGKLSFGRSRLLSRSETLRRFPMLKAEGLKAGILYYDGQFDDARMALTLAL
TASEQGAAVANRVEVVGFTHKESQLTGAEVEDRETGERWEIEARAVINAAGPFADSLRLM
ADAGAAAIMRPSSGVHIVLDKRFAPTGAGLLIPRTDDGRVLFILPFEGHALIGATDEPAA
IEDHPPPTTEAIAYLLRHIGRYLNVEVSEKDILSAWCGLRPLVSNPKIADTARLARDHIV
EVSGSGLVTICGGKWTTYRKMAADALDHAIARFDLRPKNPCRTAGLALAGAENFDAERGI
EALRSAFTLDYDVAAHLHHAYGDRAPRVLQEAGSAGAPRLHPAFPYLEAEVLYAARFEAA
LSAMDVLARRLPLALLDREAARRSAPRVIALLATERGWDQRRRDFEAAETERRLTQAI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggacaggagctccgccctggcggcgctgcgctctggcgggactttcgacgttctggtc
gtcggcggcggcgccaccggctgcggcgtcgcgctcgatgcggcgagccggggcctcagg
acggcgctcgtcgagcggggcgacttcgcggaaggcgccagcggcagaagcaccaagctg
gtgcatggcggcgtccgctaccttgagctggccattcggcgccttgaccggacacaatat
aatctggttcgcgacggcctgcgcgagcgcgcgattttcctgaaaaacgcgccgcatctt
gctcatcgtctggcgcttgtctcgccgctctaccgctggcgcgatgcgccctatatcttc
gccggtcttcgcatctacgatcggcttgccgggaagctgagcttcggccgcagccggttg
ctcagtcgcagcgaaaccctccgccgatttccgatgctgaaggccgaagggctgaaagcc
ggaattctctattatgatggtcagttcgatgacgcgcgcatggctttgacgctggcgctg
acggcgtccgaacagggcgccgcggtcgccaaccgggtcgaagtggtggggttcacccat
aaggagagccaactgaccggcgctgaggtcgaggacagggagacaggcgagcgttgggag
atcgaggcgcgcgcggtgatcaatgcggccggcccgttcgcggactcccttcgcctgatg
gcggacgccggcgcggcggcgatcatgagacccagttcaggcgtccatatcgtgctcgac
aagcgttttgctcccacgggggcggggctgctgattccgcgaaccgacgacggccgcgtg
ctgttcatactgccctttgagggacatgcgctgatcggcgccacggatgagccggctgcg
atcgaggaccatcccccgcccacgactgaggcgatcgcctatctgctgcggcacataggg
cggtatttgaacgtcgaggtcagcgaaaaggacatattatcggcgtggtgcggtcttcgt
ccgctggtcagcaacccgaaaatcgccgatacagcgcgcctcgcgcgcgatcacatcgtg
gaagtgagcgggagcggcctcgtcacgatctgcggcggcaaatggacgacctatcgaaaa
atggccgcggacgcactggatcatgccatcgcccgctttgatctgcgcccgaaaaatccg
tgccgcaccgccgggctggcgctggccggcgcggagaatttcgacgccgaaaggggaatt
gaggcgctccgctccgccttcacccttgattatgatgtcgccgcgcatctgcaccatgct
tatggcgaccgcgccccccgggtactgcaagaggccggctccgccggcgcgccgcggctc
catcccgcctttccttacctcgaggccgaggtgctctatgccgctagattcgaggccgcc
ctttcggcgatggatgtgctggcccggcgcctgccgctggctttgctcgatcgggaggcg
gcgcggcgctccgcgccccgcgtcatcgctttactcgccacggagcgcggatgggaccaa
cgccgccgggatttcgaggccgccgagacggaacggcggttgacgcaggcgatttaa

DBGET integrated database retrieval system