KEGG   Methylocella tundrae: MTUNDRAET4_1809Help
Entry
MTUNDRAET4_1809   CDS       T05970                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtun  Methylocella tundrae
Pathway
mtun00473  D-Alanine metabolism
mtun00550  Peptidoglycan biosynthesis
mtun01100  Metabolic pathways
mtun01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MTUNDRAET4_1809 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MTUNDRAET4_1809 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MTUNDRAET4_1809 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtun01011]
    MTUNDRAET4_1809 (ddlB)
Enzymes [BR:mtun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MTUNDRAET4_1809 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:mtun01011]
 Precursor biosynthesis
  Amino acid ligase
   MTUNDRAET4_1809 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: VFU08702
UniProt: A0A4U8YXL0
LinkDB All DBs
Position
1:complement(1628610..1629533)
Genome map
AA seq 307 aa AA seqDB search
MTKHVAVLMGGLSAEREVSLRSGEACAKALEAEGFNVTRLDVDRQIGERLAALRPDVAFN
ALHGRYGEDGVIQGILEMLAIPYTHSGVLASALAMRKDRARDVLRAAGVPVAKGLTVDRL
EAAKRHVLPPPYVVKPLSEGSSFGVIIVRADQAHPPQELTRADWSYGEKLLIESFVAGRE
LTCAVIGDKAYGVVEIRAADGGWYDYDAKYAPGGSIHILPANLKEFVYQNVQELALVAHR
ALGCRGVSRTDFRYDDSPGGTGELVVLEVNSQPGMTETSLVPEIAAFAGMSFGELVRWMV
EDASCDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacatgtcgccgtgctgatgggcgggctgtccgccgagcgtgaggtttcgttg
cgctccggcgaggcatgcgcgaaggctcttgaggccgaagggttcaacgtcacgcggctc
gatgttgacaggcagatcggcgaaaggctcgcggcgctgaggcccgatgtcgccttcaac
gctctgcatggtcgttacggcgaggatggcgtcatccagggcattctcgaaatgctcgcc
attccctatactcattcgggcgttctcgcctcggcgctcgccatgcgaaaggatcgcgcc
cgggacgtgctgcgcgccgccggcgttcctgtcgcaaagggcctgaccgtcgatcgtctt
gaggcggccaagcgccacgtcctgccgccgccctatgtggtgaagccgctcagcgaaggc
tcctccttcggcgtcatcatcgtgcgggccgatcaggcgcatccgccgcaggagttaacg
cgcgccgactggtcctacggcgagaaactgctgattgagagctttgtcgccggacgcgaa
ctgacctgcgcggtcattggcgacaaagcctatggcgtcgtcgaaatccgggcggccgac
ggcggctggtatgattatgacgcaaaatacgcccccggcggctccatccacatccttccg
gcaaatcttaaagaatttgtttaccaaaatgtacaagagttagctcttgtggcgcacagg
gcgctcggctgtcgtggggtaagccggaccgacttccgttacgacgattctcctggggga
acaggggaactcgtcgtgctcgaggtcaacagccagcccggaatgaccgagacctccctc
gtgcccgagatcgccgcttttgccggcatgtcttttggtgagcttgttcgatggatggtc
gaagacgcttcctgcgatcgttaa

DBGET integrated database retrieval system