KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_0235Help
Entry
CFBS_0235         CDS       T02679                                 

Definition
(GenBank) hypothetical protein
Organism
mtur  Mycobacterium tuberculosis CCDC5079
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q2
Motif
Other DBs
NCBI-ProteinID: AGL98667
LinkDB All DBs
Position
260521..261069
Genome map
AA seq 182 aa AA seqDB search
MFDIATRFKNSYGSGPLHLLAMVSGFALLGYIVATARPSALWNQATWWQSIAVWFVAAVV
AHDLLLYPLYALADRILARLVGRRDVSAPRRRPELPVRNYIRIPALAAGLTLLVFLPGII
RQGAPTYLDATGQTQEPFLGRWLLLTAVAFGISAAAYAIRLVVAHVRRRRAGCSRVDAID
EE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacattgctacgcgtttcaaaaactcctacgggtcaggtccattgcacctgctg
gcgatggtgtctggcttcgccctgctgggctacatcgtggccaccgccaggccctcggcg
ctgtggaaccaggccacctggtggcagtcgatcgcggtctggtttgtcgccgccgtcgta
gcccacgacctgctgttgtacccgctctacgcgctggccgaccggatcctggccaggcta
gtcggcaggcgcgacgtctcggcgccccgccgccgcccggaactaccggtacgcaactac
attcggatcccggcgctggcagccggcttgacgctgctggttttcctgcccggcatcatc
agacagggtgcgccgacatacctggatgcgaccggacagacgcaggaaccatttctgggc
aggtggttgctgctcaccgcggtcgcgttcgggatcagcgcggccgcttacgccattcgg
ctggtggtggcgcacgtgaggcggcgccgagcggggtgttcgcgggtcgacgcgatcgac
gaggagtag

DBGET integrated database retrieval system