KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_3766Help
Entry
CFBS_3766         CDS       T02679                                 

Gene name
echA20
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur00071  Fatty acid degradation
mtur00280  Valine, leucine and isoleucine degradation
mtur00281  Geraniol degradation
mtur00310  Lysine degradation
mtur00360  Phenylalanine metabolism
mtur00362  Benzoate degradation
mtur00380  Tryptophan metabolism
mtur00410  beta-Alanine metabolism
mtur00627  Aminobenzoate degradation
mtur00640  Propanoate metabolism
mtur00650  Butanoate metabolism
mtur00903  Limonene and pinene degradation
mtur00930  Caprolactam degradation
mtur01100  Metabolic pathways
mtur01110  Biosynthesis of secondary metabolites
mtur01120  Microbial metabolism in diverse environments
mtur01130  Biosynthesis of antibiotics
mtur01212  Fatty acid metabolism
Module
mtur_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CFBS_3766 (echA20)
   00650 Butanoate metabolism
    CFBS_3766 (echA20)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFBS_3766 (echA20)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFBS_3766 (echA20)
   00310 Lysine degradation
    CFBS_3766 (echA20)
   00360 Phenylalanine metabolism
    CFBS_3766 (echA20)
   00380 Tryptophan metabolism
    CFBS_3766 (echA20)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFBS_3766 (echA20)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFBS_3766 (echA20)
   00281 Geraniol degradation
    CFBS_3766 (echA20)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFBS_3766 (echA20)
   00627 Aminobenzoate degradation
    CFBS_3766 (echA20)
   00930 Caprolactam degradation
    CFBS_3766 (echA20)
Enzymes [BR:mtur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFBS_3766 (echA20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGM02199
LinkDB All DBs
Position
3991252..3991995
Genome map
AA seq 247 aa AA seqDB search
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANSDTRAVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIV
ASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRD
QLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHR
DAFVKKS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacctccaccacgcccgaaccgggcatcgtcgcggtcaccgtcgactacccg
ccggtcaacgccatcccgtcgaaagcgtggttcgacctggccgacgcggtgacggccgcg
ggcgccaactccgacacccgcgcggtgatcctgcgggccgaggggcgcggcttcaacgcc
ggggtggacatcaaagagatgcaacgaaccgaaggtttcacggcgctgatcgacgccaac
cgcggctgcttcgccgcattccgcgccgtctacgagtgcgcggtgccggtgatcgccgcc
gtgaacggattctgcgtgggcggcggcatcggcctggtcggcaactccgacgtcatcgtg
gcctccgaggacgccaccttcggcctgcccgaggtggaacggggcgcgctgggcgcggcc
acgcacctctcgcggctggtgccccagcacctgatgcgacggctgttctttacggcggcc
accgtggacgcggccaccttgcagcacttcggctcggtgcacgaggtggtgtcccgcgat
cagctggacgaggccgctttgcgggtggcccgcgacatcgccgccaaagacacccgggtc
atccgcgccgccaaggaggcgctgaacttcatcgacgtgcaacgggtcaatgcgagttac
cggatggagcaaggttttaccttcgagctcaacctcgccggagtcgccgacgagcaccgc
gacgcctttgtgaagaagtcatag

DBGET integrated database retrieval system