KEGG   Mycobacterium tuberculosis CCDC5079: CFBS_3882Help
Entry
CFBS_3882         CDS       T02679                                 

Gene name
dppD
Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
mtur  Mycobacterium tuberculosis CCDC5079
Pathway
mtur02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtur00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CFBS_3882 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtur02000]
    CFBS_3882 (dppD)
Transporters [BR:mtur02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CFBS_3882 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 DUF87 AAA_16 AAA_29 AAA_21 SMC_N NACHT RsgA_GTPase Mg_chelatase AAA_33 AAA_24 Sigma54_activat MMR_HSR1 AAA_5 Zeta_toxin NB-ARC ATPase AAA_7 T2SSE DUF3987 AIG1
Motif
Other DBs
NCBI-ProteinID: AGM02314
LinkDB All DBs
Position
complement(4104370..4106016)
Genome map
AA seq 548 aa AA seqDB search
MSVPAAPLLSVEGLEVTFGTDAPAVCGVDLAVRSGQTVAVVGESGSGKSTTAAAILGLLP
AGGRITAGRVVFDGRDITGADAKRLRSIRGREIGYVPQDPMTNLNPVWKVGFQVTEALRA
NTDGRAARRRAVELLAEAGLPDPAKQAGRYPHQLSGGMCQRALIAIGLAGRPRLLIADEP
TSALDVTVQRQVLDHLQGLTDELGTALLLITHDLALAAQRAEAVVVVRRGVVVESGAAQS
ILQSPQHEYTRRLVAAAPSLTARSRRPPESRSRATTQAGDILVVSELTKIYRESRGAPWR
RVESRAVDGVSFRLPRASTLAIVGESGSGKSTLARMVLGLLQPTSGTVVFDGTYDVGALA
RDQVLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRVHHVGDRRQRQRAVRELVDQVAL
PSSILGRRPRELSGGQRQRVAIARALALRPEVLVCDEAVSALDVLVQAQILDLLADLQAD
LGLTYLFISHDLAVIRQIADDVLVMRAGRVVEHASTEEVFSRPRHEYTRQLLQAIPGAPS
APRKVGNL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcccagcagcgccgctgttgtcggtggagggcctggaagttacgttcggcacc
gatgctcccgccgtgtgtggggtggatctggccgtccggagcggtcaaaccgtcgccgtg
gtgggtgagtccgggtcgggcaaatccacgacggccgcggcgattcttgggttgcttccg
gctggtggacggatcaccgctggacgcgttgtgttcgacgggcgcgacatcaccggggcc
gatgccaagcggctacggtcgataaggggacgggagatcggctatgttccccaggatccg
atgaccaacctcaatccggtttggaaggtcggctttcaggtcacagaagcgttgcgggcc
aataccgacggtcgcgcagcacgacgacgggcggtggagctactcgctgaggcgggcctg
ccggatccggcgaagcaagccggacgctacccgcatcagctgtccggcggcatgtgccag
cgggcgttgattgcgatcggcttggcgggcaggccgcggctgctgatcgccgatgagccg
acgtccgcgttggatgtcaccgtgcagcggcaggtgctcgatcatcttcagggactcacc
gacgaactaggcaccgcgctgctactgatcacccacgatctggcgttggccgcgcagcgg
gccgaggctgtcgtcgtcgtccgtcgtggagtggtggtggaatccggtgcggcgcagtca
atcctgcaaagccctcagcacgagtacacccggcgcctggtggccgcggctccatcgctg
acggcgcgcagcagacgtccgccggaatcccggtcacgggcaaccacgcaggccggcgac
attctcgtcgtctcggagctgaccaagatttaccgggagtcccgcggcgcaccgtggcgg
cgggtggagtctcgcgccgtcgacggagtgtcattccggctaccgcgggcgagcaccctg
gcaatcgtcggcgaatccgggtcaggcaagtcgacgctagcgcggatggtgcttgggctg
ctccaacctacctcgggcacggtcgttttcgacggcacctacgacgtcggcgcgctggcc
cgggaccaggtgctggcctttcgccgccgggtccagccggtgttccaaaacccatacagc
agcctggatcccatgtactcggtgtttcgcgccatcgaggaaccgttacgcgtccatcac
gtcggtgaccgccggcagcggcaaagggcggtgcgtgagctggtcgatcaggtggcgctg
ccgtcgtcgatactgggccggcggccccgtgagctgtcgggtggtcagcggcagcgggta
gcgatcgcgcgtgcgctggcgctgcgcccggaggtattggtgtgcgacgaagcggtgtcg
gcgctcgacgtattggtgcaggcacagatcctggatctgctggccgatctgcaggccgac
ctgggtttgacgtatttgttcatcagccatgatctggcggtgatccggcagattgccgac
gacgtcctggtcatgcgggccggccgggtggtggagcacgcctctaccgaggaggtgttc
agccggccccgccacgagtacacccgccagttgcttcaggccattcccggtgccccctca
gctccccgaaaggttggcaacctgtga

DBGET integrated database retrieval system