KEGG   Mycobacterium tuberculosis BT1: HKBT1_3503Help
Entry
HKBT1_3503        CDS       T03152                                 

Gene name
moaX
Definition
(GenBank) MoaD-MoaE fusion protein MoaX
  KO
K21142  MoaE-MoaD fusion protein [EC:2.8.1.12]
Organism
mtut  Mycobacterium tuberculosis BT1
Pathway
mtut00790  Folate biosynthesis
mtut01100  Metabolic pathways
mtut04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mtut00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HKBT1_3503 (moaX)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HKBT1_3503 (moaX)
Enzymes [BR:mtut01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     HKBT1_3503 (moaX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE ThiS Attacin_N
Motif
Other DBs
NCBI-ProteinID: AHJ52449
LinkDB All DBs
Position
complement(3695349..3696014)
Genome map
AA seq 221 aa AA seqDB search
MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESI
APASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRN
NNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGAS
APHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattactgtcaatgtgctctactttggcgcggttcgcgaagcgtgcaaggtcgctcac
gagaagatctcactcgaaagcggcaccaccgtcgacggcttagtcgaccaattgcaaatc
gactatccgccacttgctgattttcgcaagcgagtgcggatggccgttaacgaatccata
gcgccagcatcaacgattctcgacgatggcgacacggtggcgttcataccgcaggttgcc
gggggctccgatgtctactgccggctcaccgatgagccgctgagcgtcgatgaagtgctc
aacgcgatatctggaccttcccagggcggcgccgtcatcttcgtgggtaccgtgcgtaac
aacaacaacggccacgaagtgaccaagttgtactacgaggcctatccggccatggtgcac
cgcacgctgatggacatcatcgaagagtgtgaacgacaggccgacggtgtgcgagttgcc
gtggcacaccggaccggtgaattgcgcatcggtgatgcggcggttgtcatcggtgcttcg
gctcctcaccgcgcggccgcgttcgacgccgctcgcatgtgcatcgagcggctcaaacag
gatgtgccgatatggaagaaggagttcgcactcgacggtgttgagtgggtggccaatcgg
ccatga

DBGET integrated database retrieval system