KEGG   Mycobacterium tuberculosis BT2: HKBT2_3621Help
Entry
HKBT2_3621        CDS       T03153                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
mtuu00473  D-Alanine metabolism
mtuu01100  Metabolic pathways
mtuu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HKBT2_3621 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HKBT2_3621 (alr)
Enzymes [BR:mtuu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HKBT2_3621 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mtuu01011]
 Precursor biosynthesis
  Racemase
   HKBT2_3621 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHJ48418
LinkDB All DBs
Structure
PDB: 

Position
complement(3827113..3828339)
Genome map
AA seq 408 aa AA seqDB search
MKRLWENVGKPNDTTDGRGTTSLAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQ
LMAVVKADGYGHGATRVAQTALGAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDF
GPALLADVQVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALR
QAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSAT
MARPDLTFDLVRPGIAVYGLSPVPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWI
APRDTNLALLPIGYADGVFRSLGGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEG
DEAILFGPGIRGEPTAQDWADLVGTIHYEVVTSPRGRITRTYREAENR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggttatgggagaatgtcggaaagccaaacgacacgacagatgggcggggcacg
acttcgttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtg
gatctgggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcag
ctgatggcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaacc
gccctgggagccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctg
cgcgctgatggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttc
gggcccgcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaa
ctgttgcacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggatacc
gggctgaaccgcaatggcgtgggaccggcacaattcccggccatgctgaccgcgttacgc
caagccatggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgcc
gacaagcctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcg
caggcccgcgaacaaggggtgcggttcgaggtggcgcatctatcgaactcatcagcaact
atggcgcgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggcta
agcccggtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgct
gttgcgctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacatggatc
gcgccacgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccgg
tcgctgggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcgg
atctgcatggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggc
gacgaggcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggcc
gatcttgtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccagg
acctatcgcgaggctgaaaaccgttga

DBGET integrated database retrieval system