KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0352Help
Entry
RVBD_0352         CDS       T02178                                 

Definition
(GenBank) chaperone DnaJ1
  KO
K03686  molecular chaperone DnaJ
Organism
mtv  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mtv03110]
    RVBD_0352
   03029 Mitochondrial biogenesis [BR:mtv03029]
    RVBD_0352
Chaperones and folding catalysts [BR:mtv03110]
 Heat shock proteins
  HSP40 / DNAJ
   RVBD_0352
Mitochondrial biogenesis [BR:mtv03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    RVBD_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP
Motif
Other DBs
NCBI-ProteinID: AFN48207
UniProt: P9WNV9
LinkDB All DBs
Position
422452..423639
Genome map
AA seq 395 aa AA seqDB search
MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAAGERFKAVSEAHN
VLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGDGAEFNLNDLFDAASRT
GGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNC
HGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTT
RTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKIFGRDGDDLTVTV
PVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRGRGVPKRSGGSGDLLVTVKVA
VPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaagggaatgggtcgaaaaagacttctaccaggagctgggcgtctcctctgat
gccagtcctgaagagatcaaacgtgcctatcggaagttggcgcgcgacctgcatccggac
gcgaacccgggcaacccggccgccggcgaacggttcaaggcggtttcggaggcgcataac
gtgctgtcggatccggccaagcgcaaggagtacgacgaaacccgccgcctgttcgccggc
ggcgggttcggcggccgtcggttcgacagcggctttgggggcgggttcggcggtttcggg
gtcggtggagacggcgccgagttcaacctcaacgacttgttcgacgccgccagccgaacc
ggcggtaccaccatcggtgacttgttcggtggcttgttcggacgcggtggcagcgcccgt
cccagccgcccgcgacgcggcaacgacctggagaccgagaccgagttggatttcgtggag
gccgccaagggcgtggcgatgccgctgcgattaaccagcccggcgccgtgcaccaactgc
catggcagcggggcccggccaggcaccagcccaaaggtgtgtcccacttgcaacgggtcg
ggcgtgatcaaccgcaatcagggcgcgttcggcttctccgagccgtgcaccgactgccga
ggtagcggctcgatcatcgagcacccctgcgaggagtgcaaaggcaccggcgtgaccacc
cgcacccgaaccatcaacgtgcggatcccgcccggtgtcgaggatgggcagcgcatccgg
ctagccggtcagggcgaggccgggttgcgcggcgctccctcgggggatctctacgtgacg
gtgcatgtgcggcccgacaagatcttcggccgcgacggcgacgacctcaccgtcaccgtt
ccggtcagcttcaccgaattggctttgggctcgacgctgtcggtgcctaccctggacggc
acggtcggggtccgggtgcccaaaggcaccgctgacggccgcattctgcgtgtgcgcgga
cgcggtgtgcccaagcgcagtgggggtagcggcgacctacttgtcaccgtgaaggtggcc
gtgccgcccaatttggcaggcgccgctcaggaagctctggaagcctatgcggcggcggag
cggtccagtggtttcaacccgcgggccggatgggcaggtaatcgctga

DBGET integrated database retrieval system