KEGG   Mycobacterium tuberculosis H37Rv: RVBD_0938Help
Entry
RVBD_0938         CDS       T02178                                 

Definition
(GenBank) ATP dependent DNA ligase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mtv  Mycobacterium tuberculosis H37Rv
Pathway
mtv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RVBD_0938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtv03400]
    RVBD_0938
Enzymes [BR:mtv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RVBD_0938
DNA repair and recombination proteins [BR:mtv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RVBD_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFN48823
UniProt: P9WNV3
LinkDB All DBs
Structure
PDB: 

Position
1046140..1048419
Genome map
AA seq 759 aa AA seqDB search
MGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQ
PAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAE
PGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLY
TPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAP
YSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTRY
RRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLECDGVLVSWAVPKNLPDN
TSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDDPHTGEVIVNL
HGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHGTVAGLKASQWAFEG
KWDGYRLLVEADHGAVRLRSRSGRDVTAEYPQLRALAEDLADHHVVLDGEAVVLDSSGVP
SFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELLPGDG
AQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWRAGEGGRSSGV
GSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFDVPLPARDAKGITYV
KPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgtcggagcaacgggtgacgctgaccaacgccgacaaggtgctctatccc
gccaccgggaccacaaagtccgatatcttcgactactacgccggtgttgccgaagtcatg
ctcggccacatcgcgggacggccggcgacgcgcaagcgctggcctaacggcgtcgaccaa
cccgcgttcttcgaaaagcagttggcgttgtcggcgccgccttggctgtcacgtgcaacg
gtggcgcaccggtccgggacgacgacctatccgatcatcgatagcgcaaccgggctggcc
tggatcgcccaacaggcggcgctggaggtgcacgtgccgcagtggcggtttgtcgccgag
cccggatcaggtgagttaaatccgggcccggcaacgcgtttggtgttcgacctggacccg
ggcgaaggcgtgatgatggcccagctggccgaggtggcgcgcgcggttcgtgatcttctc
gccgatatcgggttggtcaccttcccggtcaccagcggcagcaagggattgcatctgtac
acaccgctggatgagccggtgagcagcaggggagccacggtgttggccaagcgcgtcgcg
cagcgattggagcaggcgatgcccgcgttggtcacctcgaccatgaccaaaagcctgcgg
gccgggaaggtgtttgtggactggagccagaacagcggctcgaagaccaccatcgcgccg
tactcactacgtggccggacgcatccgaccgtcgcggcgccacgcacctgggcggagctc
gacgaccccgcactgcgtcagctctcctacgacgaggtgctgacccggattgcccgcgac
ggcgatctgctcgagcggctggatgccgacgctccggtagcggaccggttgacccgatac
cgccgcatgcgcgacgcatcgaaaactcccgagccgattcccacggcgaaacccgttacc
ggagacggcaatacgttcgtcatccaggagcatcacgcgcgtcggccgcactacgatttc
cggctggaatgcgacggcgtgctggtctcgtgggcggtaccgaaaaacctgcccgacaac
acatcggttaaccatctagcgatacacaccgaggaccacccgctggaatacgccacgttc
gagggcgcgattcccagcggggagtacggcgccggcaaggtgatcatctgggactccggc
acttacgacaccgagaagttccacgatgacccgcacacgggggaggtcatcgtgaatctg
cacggcggccggatctctgggcgttatgcgctgattcggaccaacggcgatcggtggctg
gcgcaccgcctaaagaatcagaaagaccagaaggtgttcgagttcgacaatctggcccca
atgcttgccacgcacggcacggtggccggtctaaaggccagccagtgggcgttcgaaggc
aagtgggacggctaccggttgctggttgaggctgaccacggcgccgtgcggctgcggtcc
cgcagcgggcgcgatgtcaccgccgagtatccgcaattgcgggcattggcggaggatctc
gccgatcaccacgtggtgctggacggcgaggccgtcgtacttgactcctctggtgtgccc
agcttcagccagatgcagaatcggggccgcgacacccgtgtcgagttctgggcgttcgac
ctgctctacctcgacggccgcgcgctgctaggcacccgctaccaagaccggcgtaagctg
ctcgaaaccctagctaacgcaaccagtctcaccgttcccgagctgctgcccggtgacggc
gcccaagcgtttgcgtgctcgcgcaagcacggctgggagggcgtgatcgccaagaggcgt
gactcgcgctatcagccgggccggcgctgcgcgtcgtgggtcaaggacaagcactggaac
acccaggaagtcgtcattggtggctggcgcgccggggaaggcgggcgcagcagtggcgtc
gggtcgctgctcatgggcatccccggtccaggtgggctgcagttcgccgggcgggtcggt
accggcctcagcgaacgcgaactggccaacctcaaggagatgctggcgccgctgcatacc
gacgagtcccccttcgacgtaccactgcccgcgcgtgacgccaagggcatcacatatgtc
aagccggcgctggttgcagaggtgcgctacagcgagtggactccggagggccggctgcgt
caatcaagctggcgtgggctgcggccggacaagaaacccagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system