KEGG   Methylosinus trichosporium: CQW49_01090Help
Entry
CQW49_01090       CDS       T05155                                 

Definition
(GenBank) Holliday junction resolvase RuvX
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
mtw  Methylosinus trichosporium
Brite
KEGG Orthology (KO) [BR:mtw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CQW49_01090
Enzymes [BR:mtw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     CQW49_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-ProteinID: ATQ66643
UniProt: A0A2D2CV78
LinkDB All DBs
Position
complement(228746..229228)
Genome map
AA seq 160 aa AA seqDB search
MTDKRTTVEELAALLPAKGRLMGLDVGTKTIGLALSDVERRLASPLETIRRGKFTSDAER
LGALVAQFDIAALIVGLPLNMDGSEGPRAQATRAFMRNLGARFALRYAFWDERLSTAAVT
RELLAQDASRAKRAAVVDRMAAAYILQGALDRLRRLASPV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaaacgcacgactgtcgaggagctggccgcgcttctgcccgccaagggccgg
ctgatggggctcgatgtcggaaccaagaccatcggcctcgcgctctcggatgtggagcgc
cgcctcgcctcgcccttggagacgatccgccgcggcaaattcacgtctgacgcggagcgt
ctcggcgcgctcgtcgcgcaattcgacatcgccgcgctgattgtcggcctgccgctcaac
atggacgggtccgaaggcccgcgcgcgcaagcgacacgggccttcatgcgcaatctcggc
gcgcgcttcgcgctgcgctacgccttctgggacgagcggctttcgaccgccgccgtcacc
agagagctgctggcgcaggacgcctcgcgcgccaagcgggcggcggtcgtggaccgaatg
gccgccgcctacattctgcaaggcgccctcgacaggctcaggcgcctcgcctcgccagtc
tag

DBGET integrated database retrieval system